Cat: IPD-X17477

Recombinant Human CD58 Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD58

  • 简介

    CD58, a glycoprotein, is also known as lymphocyte-function antigen 3 (LFA-3). CD58 is a costimulatory receptor, and can interact with its natural ligand (CD2, primarily expressed on the surface of T/NK cells). The CD2-CD58 interaction can promote cell adhesion and recognition, and regulate antiviral responses, inflammatory responses in autoimmune diseases, immune rejection of transplantation, and immune evasion of tumor cells[1]. CD58 Protein, Human (HEK293, His) is the recombinant human-derived CD58 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured in a cell proliferation assay using PHA-stimulated THP-1 human erythroleukemic cells. The ED50 for this effect is 0.4424 μg/mL,corresponding to a specific activity is 2.26×103 units/mg. Measured in a cell proliferation assay using PHA-stimulated THP-1 human erythroleukemic cells. The ED50 for this effect is 0.4424 μg/mL, corresponding to a specific activity is 2.26×103 units/mg.

  • Alternative Names

    Lymphocyte Function-Associated Antigen 3; Surface Glycoprotein LFA-3; CD58; LFA3; Ag3; CD58 antigen

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    AAH05930

  • Expression Region

    F29-R215

  • AA Sequence

    FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR

  • Protein Length

    Partial

  • Molecular Weight

    30-60 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD58, also known as lymphocyte function-associated antigen 3 (LFA-3), is a cell surface protein that plays a critical role in the immune system by facilitating the interaction between antigen-presenting cells and T cells. Understanding CD58's structure and function is vital for developing targeted immunotherapies for various diseases, including cancers and autoimmune disorders. The recombinant form of CD58 has been utilized in various studies to elucidate its effects on T-cell activation and proliferation. Research indicates that CD58 enhances T-cell responses by binding to CD2, promoting stronger adhesion and signaling pathways necessary for effective immune responses. Recent investigations focus on the therapeutic potential of CD58 in enhancing the efficacy of existing immunotherapies, as well as its role in the tumor microenvironment where it may influence immune evasion mechanisms employed by cancer cells. The generation of CD58 recombinant protein allows for detailed studies into its mechanistic roles, interactions, and potential as a biomarker in clinical settings. This research could pave the way for novel treatments that harness the body's immune system more effectively, emphasizing the importance of CD58 in immune modulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US