Analytical Data
-
Gene name
SLAMF2/CD48
-
简介
SLAMF2/CD48 protein is a GPI-anchored glycoprotein that regulates immune cell function by interacting with CD2 and CD244. SLAMF2/CD48 Protein, Human (HEK293, His) is the recombinant human-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
CD48 antigen; SLAMF2; TCT.1; CD48; BCM1; BLAST1
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09326
-
Expression Region
Q27-S220
-
AA Sequence
MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLAMF2, also known as CD48, is a crucial member of the SLAM (Signaling Lymphocyte Activation Molecule) family of proteins, which play significant roles in immune responses and cell signaling. The CD48 protein is primarily expressed on immune cells, including T cells, B cells, and natural killer (NK) cells, and acts as a co-stimulatory molecule that influences the activation, differentiation, and function of these cells. Research on SLAMF2/CD48 has gained attention due to its involvement in various immune disorders, infectious diseases, and cancers. Understanding the structure and function of SLAMF2/CD48 is essential for developing potential therapeutic strategies, as modulation of its activity may enhance immune responses or suppress aberrant ones. The generation of recombinant SLAMF2/CD48 proteins facilitates detailed studies of its interactions with ligands and receptors, as well as its signaling pathways. This research is pivotal in elucidating the mechanisms underlying immune regulation and could lead to novel immunotherapeutic approaches for boosting antitumor immunity or treating autoimmune diseases. Thus, the study of SLAMF2/CD48 recombinant proteins not only provides insights into fundamental immunological processes but also holds promise for advancing clinical applications in immunology and oncology.











