Analytical Data
-
Gene name
LILRA1/LIR-6/CD85i
-
简介
LILRA1/LIR-6/CD85i protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and response. Its interaction with class I MHC molecules suggests involvement in monitoring and possibly influencing immune activity. LILRA1/LIR-6/CD85i Protein, Human (HEK293, His) is the recombinant human-derived LILRA1/LIR-6/CD85i protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human LILRA1 at 2 μg/mL (100 μL/well) can bind Human ANGPTL7, The ED50 for this effect is 1.143 μg/mL. Measured by its binding ability in a functional ELISA. Immobilized Human LILRA1 at 2 μg/mL (100 μL/well) can bind Human ANGPTL7, The ED50 for this effect is 1.143 μg/mL.
-
Alternative Names
Leukocyte immunoglobulin-like receptor subfamily A member 1; CD85 antigen-like family member I
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
O75019-1
-
Expression Region
P17-N461
-
AA Sequence
PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVEN
-
Protein Length
Extracellular Domain
-
Molecular Weight
70-75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LILRA1, also known as LIR-6 or CD85i, belongs to the immunoglobulin superfamily, specifically the leukocyte immunoglobulin-like receptors (LIR) that play vital roles in immune regulation. This receptor is primarily expressed on myeloid cells and is involved in modulating immune responses, particularly in the context of inflammation and infection. It functions by inhibiting immune cell activation, thereby helping to maintain homeostasis and prevent excessive immune responses that could lead to autoimmunity or tissue damage. Research has shown that LILRA1 can bind to various ligands, including MHC class I molecules, which further highlights its importance in modulating T cell responses. Additionally, studies suggest that LILRA1 may play a role in tumor immunology, influencing the microenvironment and affecting the efficacy of anti-tumor immunity. The generation of recombinant LILRA1 protein has enabled further investigation into its structural properties, ligand interactions, and biological functions. Understanding the mechanisms by which LILRA1 regulates immune responses could provide valuable insights for therapeutic strategies aimed at enhancing immune responses in cancer or dampening inflammation in autoimmune diseases. As such, LILRA1 presents a promising target for novel immunotherapies and could lead to advancements in personalized medicine.
