Cat: IPD-X17417

Recombinant Human ILT6 Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ILT6

  • 简介

    LILRA3/CD85e/ILT6 functions as a soluble receptor for class I MHC antigens, binding both classical and non-classical HLA class I molecules, albeit with lower affinities than LILRB1 or LILRB2. It engages with monocyte surfaces, effectively suppressing LPS-induced TNF-alpha production by monocytes. ILT6 Protein, Human (HEK293, His) is the recombinant human-derived ILT6 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N6C8-1

  • Expression Region

    T19-E439

  • AA Sequence

    THVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

  • Protein Length

    Partial

  • Molecular Weight

    60-90 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ILT6 (Immunoglobulin-like Transcript 6) is a member of the ILT family of receptors, which are known to play crucial roles in the modulation of the immune response. This receptor is primarily expressed on immune cells such as monocytes and dendritic cells and is implicated in immune regulation and tolerance. Research into ILT6 has gained momentum due to its potential involvement in various diseases, including autoimmunity, cancer, and infectious diseases. By understanding the structure and function of ILT6, scientists aim to elucidate its mechanism of action, particularly how it influences the balance between pro-inflammatory and anti-inflammatory responses. Recombinant ILT6 protein has been produced to study its interaction with ligands and other surface receptors, enabling exploration of its signaling pathways and biological effects. Additionally, the manipulation of ILT6 expression presents therapeutic opportunities for enhancing immune responses in cancer immunotherapy or promoting tolerance in transplant medicine. As such, ILT6 represents a promising target for developing novel immunomodulatory strategies, underscoring the need for continued research in this area.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US