Cat: IPD-X17406

Recombinant Human LILRB3/CD85a Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LILRB3/CD85a

  • 简介

    LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Recombinant Human CD85a is present at 2 μg/mL can bind Recombinant Human Angiopoietin-like 7. The ED50 for this effect is 261.4 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Human CD85a is present at 2 μg/mL can bind Recombinant Human Angiopoietin-like 7.The ED50 for this effect is 261.4 ng/mL.

  • Alternative Names

    Leukocyte immunoglobulin-like receptor subfamily B member 3; LIR-3; ILT-5; CD85a

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    O75022

  • Expression Region

    G24-E443

  • AA Sequence

    GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

  • Protein Length

    Partial

  • Molecular Weight

    55-75 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LILRB3, also known as CD85a, is a member of the leukocyte immunoglobulin-like receptors (LILR) family, which play a crucial role in modulating immune responses. The significance of LILRB3 lies in its ability to interact with major histocompatibility complex (MHC) class I molecules, thereby influencing the activity of various immune cells, including T cells and natural killer (NK) cells. Research into LILRB3/CD85a has gained momentum due to its potential implications in immunology and therapeutic interventions, particularly in cancer, autoimmune diseases, and transplant rejection. The expression of LILRB3 on immune cells often correlates with immune evasion mechanisms employed by tumors, making it a target of interest for developing novel immunotherapeutic strategies. Additionally, the study of LILRB3/CD85a recombinant proteins facilitates a deeper understanding of its structure-function relationships, signaling pathways, and interactions with other immune regulators. As researchers explore the modulation of LILRB3 activity, the development of recombinant proteins can serve as valuable tools for elucidating its biological roles and assessing its therapeutic potential in enhancing anti-tumor immunity or restoring immune tolerance in various clinical contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US