Analytical Data
-
Gene name
LILRB3/CD85a
-
简介
LILRB3/CD85a protein, as a receptor for class I MHC antigens, plays an indispensable role in immune recognition. Activation of LILRB3 occurs through binding to immune receptors such as FCGR2B and B cell receptors, resulting in downregulation of antigen-induced B cell activation. LILRB3/CD85a Protein, Human (HEK293, His) is the recombinant human-derived LILRB3/CD85a protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Human CD85a is present at 2 μg/mL can bind Recombinant Human Angiopoietin-like 7. The ED50 for this effect is 261.4 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Human CD85a is present at 2 μg/mL can bind Recombinant Human Angiopoietin-like 7.The ED50 for this effect is 261.4 ng/mL.
-
Alternative Names
Leukocyte immunoglobulin-like receptor subfamily B member 3; LIR-3; ILT-5; CD85a
-
Species
Human
-
Source
HEK293
-
Tag
C-10*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
O75022
-
Expression Region
G24-E443
-
AA Sequence
GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE
-
Protein Length
Partial
-
Molecular Weight
55-75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LILRB3, also known as CD85a, is a member of the leukocyte immunoglobulin-like receptors (LILR) family, which play a crucial role in modulating immune responses. The significance of LILRB3 lies in its ability to interact with major histocompatibility complex (MHC) class I molecules, thereby influencing the activity of various immune cells, including T cells and natural killer (NK) cells. Research into LILRB3/CD85a has gained momentum due to its potential implications in immunology and therapeutic interventions, particularly in cancer, autoimmune diseases, and transplant rejection. The expression of LILRB3 on immune cells often correlates with immune evasion mechanisms employed by tumors, making it a target of interest for developing novel immunotherapeutic strategies. Additionally, the study of LILRB3/CD85a recombinant proteins facilitates a deeper understanding of its structure-function relationships, signaling pathways, and interactions with other immune regulators. As researchers explore the modulation of LILRB3 activity, the development of recombinant proteins can serve as valuable tools for elucidating its biological roles and assessing its therapeutic potential in enhancing anti-tumor immunity or restoring immune tolerance in various clinical contexts.











