Analytical Data
-
Gene name
CEACAM8/CD66b
-
简介
CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (His-SUMO) is the recombinant human-derived CEACAM8/CD66b protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His;N-SUMO
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31997
-
Expression Region
Q35-D320
-
AA Sequence
QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
-
Protein Length
Full Length of Mature Protein
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CEACAM8, also known as CD66b, is a member of the carcinoembryonic antigen-related cell adhesion molecule (CEACAM) family that plays a crucial role in the immune response, particularly in neutrophil function and inflammation. This glycoprotein is primarily expressed on the surface of neutrophils and has been implicated in neutrophil adhesion, migration, and activation. Its interaction with other immune cells and pathogens has made it a subject of interest in both immunology and oncology. Research has shown that CEACAM8/CD66b can enhance neutrophil responses during infections and contribute to the pathogenesis of various diseases, including autoimmune disorders and cancer. The study of recombinant CEACAM8/CD66b proteins has garnered attention for their potential therapeutic applications, such as in the development of vaccines or as biomarkers for disease progression. Understanding the structural and functional properties of this protein can provide insights into its role in immune signaling and may contribute to novel treatment strategies targeting inflammatory diseases. Advances in recombinant protein technology have allowed for the production and characterization of CEACAM8/CD66b, facilitating investigations into its biological functions and interactions. Consequently, ongoing research in this area aims to elucidate the molecular mechanisms underlying CEACAM8/CD66b's involvement in immune responses and its potential as a therapeutic target in various clinical settings.











