Analytical Data
-
Gene name
EpCAM/TROP1
-
简介
The EpCAM/TROP1 protein serves as a multifunctional molecule that promotes homogeneous interactions between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) in the mucosal epithelium. This suggests a crucial role in establishing an immune barrier against mucosal infection. EpCAM/TROP1 Protein, Rat (HEK293, His) is the recombinant rat-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by the ability of the immobilized protein to support the adhesion of the L929 mouse fibroblast cell line. The ED50 for this effect is 1.332 μg/mL in the presence of 0.5 μg/mL Fibronectin, corresponding to a specific activity is 750.751 units/mg. Measured by the ability of the immobilized protein to support the adhesion of the L929 mouse fibroblast cell line. The ED50 for this effect is 1.332 μg/mL in the presence of 0.5 μg/mL Fibronectin, corresponding to a specific activity is 750.751 units/mg.
-
Alternative Names
Epithelial cell adhesion molecule; Ep-CAM; EGP; KSA; CD326; TROP1
-
Species
Rat
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
O55159
-
Expression Region
Q24-T266
-
AA Sequence
QKDCVCNNYKLTSRCYENENGECQCTSYGTQNTVICSKLASKCLVMKAEMTHSKSGRRMKPEGAIQNNDGLYDPECDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERAQPYNFESLHTALQDTFASRYMLNPKFIKSIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGELLDLDPGQTLIYYVDEKAPEFSMQGLT
-
Protein Length
Extracellular Domain
-
Molecular Weight
30-36 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on EpCAM (Epithelial Cell Adhesion Molecule) and TROP-1 (Tumor-Related Protein 1) recombinant proteins has gained significant attention due to their critical roles in cancer biology and potential as therapeutic targets. EpCAM is a transmembrane glycoprotein highly expressed in various epithelial cancers, such as breast, colorectal, and lung cancer, and is associated with cell proliferation, differentiation, and adhesion. Its aberrant expression is often linked to tumor progression and metastasis, making it an attractive target for antibody-based therapies. Similarly, TROP-1, also known as TAG-72, is a tumor-associated glycoprotein found in several malignancies and serves as a marker for cancer diagnosis and treatment. The development of recombinant forms of these proteins allows for more detailed studies on their structure, function, and interaction with other cellular components. Moreover, these recombinant proteins can be utilized in the generation of specific antibodies or as part of immunotherapeutic strategies, enhancing the ability to target and eliminate cancer cells while sparing normal tissues. Overall, the exploration of EpCAM and TROP-1 recombinant proteins presents promising avenues for innovative cancer therapies and improved patient outcomes.











