Analytical Data
-
Gene name
Melanotransferrin/CD228
-
简介
Melanotransferrin/CD228 protein is involved in cellular iron uptake, undergoing internalization and recycling to the cell membrane. Each subunit binds a single iron atom, suggesting a role in intracellular iron transport. Melanotransferrin/CD228 also exhibits potential zinc binding, showcasing versatile metal ion interactions. Melanotransferrin/CD228 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Melanotransferrin/CD228 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.088 μg/mL, corresponding to a specific activity is 919.118 units/mg. Measured in a cell proliferation assay using SH-SY5Y cells. The ED50 for this effect is 1.088 μg/mL, corresponding to a specific activity is 919.118 units/mg.
-
Alternative Names
Melanotransferrin; MTf; CD228; MELTF; MFI2
-
Species
Mouse
-
Source
HEK293
-
Tag
C-10*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
Q9R0R1
-
Expression Region
V20-Q708
-
AA Sequence
VMEVQWCTISDAEQQKCKDMSEAFQGAGIRPSLLCVQGNSADHCVQLIKEQKADAITLDGGAIYEAGKEHGLKPVVGEVYDQDIGTSYYAVAVVRRNSNVTINTLKGVKSCHTGINRTVGWNVPVGYLVESGHLSVMGCDVLKAVGDYFGGSCVPGTGETSHSESLCRLCRGDSSGHNVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGNTLPSWGKSLMSEDFQLLCRDGSRADITEWRRCHLAKVPAHAVVVRGDMDGGLIFQLLNEGQLLFSHEDSSFQMFSSKAYSQKNLLFKDSTLELVPIATQNYEAWLGQEYLQAMKGLLCDPNRLPHYLRWCVLSAPEIQKCGDMAVAFSRQNLKPEIQCVSAESPEHCMEQIQAGHTDAVTLRGEDIYRAGKVYGLVPAAGELYAEEDRSNSYFVVAVARRDSSYSFTLDELRGKRSCHPYLGSPAGWEVPIGSLIQRGFIRPKDCDVLTAVSQFFNASCVPVNNPKNYPSALCALCVGDEKGRNKCVGSSQERYYGYSGAFRCLVEHAGDVAFVKHTTVFENTNGHNPEPWASHLRWQDYELLCPNGARAEVDQFQACNLAQMPSHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFQMFDSSKYHSQDLLFKDATVRAVPVREKTTYLDWLGPDYVVALEGMLSQQ
-
Protein Length
Partial
-
Molecular Weight
80 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Melanotransferrin, also known as CD228, is a glycoprotein primarily implicated in iron transport and the modulation of cell growth and differentiation. Initially identified in melanoma cells, its expression is associated with various physiological and pathological conditions, including cancer. Melanotransferrin's unique structure, featuring a transferrin-like domain, allows it to bind iron, which is crucial for cellular functions. Studies have suggested that melanotransferrin may play a role in cellular processes beyond iron metabolism, such as cellular signaling and the regulation of immune responses. The interest in recombinant forms of melanotransferrin has grown significantly, as these proteins can be utilized in therapeutic and diagnostic applications, including targeted drug delivery systems and cancer immunotherapy. Additionally, due to its differential expression in tumors compared to normal tissues, melanotransferrin serves as a potential biomarker for cancer diagnosis and prognosis. Understanding the structure-function relationship of recombinant melanotransferrin can provide insights into its biological roles and lead to novel intervention strategies in cancer therapeutics. Research into this versatile protein continues to expand, highlighting its potential in various biomedical fields.











