Recombinant Rat DNAM-1 Protein(HEK293) , His

DNAM-1

DNAM-1 protein is a key player in cell-cell adhesion and lymphocyte signaling, mediating cytotoxicity and lymphokine secretion of CTL and NK cells. As a receptor for NECTIN2, DNAM-1 stimulates T cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG) upon ligand binding. DNAM-1 Protein, Rat (HEK293, His) is the recombinant rat-derived DNAM-1 protein, expressed by HEK293 , with C-His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured by its binding ability in a functional ELISA. Immobilized Rat DNAM-1 at 1 μg/mL (100 μL/well) can bind biotinylated CD155 Protein. The ED50 for this effect is 7.119 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Rat DNAM-1 at 1μg/mL (100 μL/well) can bind biotinylated CD155 Protein. The ED50 for this effect is 7.119 ng/mL.

CD226 antigen; DNAX accessory molecule 1; DNAM-1; CD226

Rat

HEK293

C-His

Greater than 95% as determined by reducing SDS-PAGE.

D3ZS97

E32-I265

EETLWDTTVRLSETMTLECVYPLTDNLTQAEWTKDTGTKKVNIAVYHPNHNMHIDPNYLHRVHFQNATVGFRNMSLSFYNASEADIGIYTCLFHAFPRGSWEKKIKVVQSDSFETTAPLDSYLSAEPGQNVTLSCQLERTWLVQLVIWEKVQPHQVDILASCNLSQGTRYTSKYLRQTWSDCSQESMKSALIIPYAMAADSGLYRCRSEASTGTNKTCVIRLIITDGGTNNHFI

Partial

28 kDa.

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.