Analytical Data
-
Gene name
Mucin-1/MUC1
- Application
-
Alternative Names
MUC1/Y; MUC1; MUC-1; Mucin-1; Mucin1; CA 15-3; Episialin; H23AG; KL-6; PEMT; PUM; PEM; EMA; CD227;
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q02496-1
-
Expression Region
F21-G535
-
AA Sequence
FLALPSEENSVTSSQDTSSSLASTTTPVHSSNSDPATRPPGDSTSSPVQSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVNSASSPVAHGDTSSPATSLSKDSNSSPVVHSGTSSAATTAPVDSTSSPVVHGGTSSPATSPPGDSTSSPDHSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVDSTSSPVAHDDTSSPATSLSEDSASSPVAHGGTSSPATSPLRDSTSSPVHSSASIQNIKTTSDLASTPDHNGTSVTTTSSALGSATSPDHSGTSTTTNSSESVLATTPVYSSMPFSTTKVTSGSAIIPDHNGSSVLPTSSVLGSATSLVYNTSAIATTPVSNGTQPSVPSQYPVSPTMATTSSHSTIASSSYYSTVPFSTFSSNSSPQLSVGVSFFFLSFYIQNHPFNSSLEDPSSNYYQELKRNISGLFLQIFNGDFLGISSIKFRSGSVVVESTVVFREGTFSASDVKSQLIQHKKEADDYNLTISEVKVNEMQFPPSAQSRPGVPGWG
-
Protein Length
Extracellular Domain
-
Molecular Weight
9 kDa & 65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Mucin-1 (MUC1) is a glycoprotein that plays a crucial role in the protection and lubrication of epithelial surfaces, functioning as a component of mucosal barriers in various tissues, including the breast, gastrointestinal tract, and respiratory tract. Abnormal expression of MUC1 is associated with several malignancies, notably breast and ovarian cancers, where it is overexpressed and contributes to tumor progression and immune evasion. The study of MUC1 has garnered significant attention in cancer immunotherapy, as it presents a target for vaccine development and monoclonal antibody therapies. Researchers have focused on producing recombinant MUC1 proteins to investigate their structure, function, and potential applications in diagnostics and therapeutics. These recombinant proteins can be utilized in the generation of MUC1-specific antibodies, understanding the mechanisms of MUC1-mediated cell signaling, and enhancing immune responses against MUC1-expressing tumors. Furthermore, research has aimed at leveraging MUC1 epitopes in vaccine formulations to stimulate a robust anti-tumor immune response in patients. The successful generation and characterization of recombinant MUC1 have paved the way for innovative treatment strategies that target this protein, underscoring its importance in cancer research and therapy.











