Cat: IPD-X15662

Recombinant Human Coagulation factor III/F3 Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Coagulation factor III/F3

  • 简介

    Coagulation factor III/F3 Protein, Human (HEK293, His) is a recombinant human CD142 expressed in HEK 293 cells with a His tag at the C-terminus. Coagulation Factor III/CD142 Protein is a principal regulator of oncogenic neoangiogenesis and controls therefore the cancerous process[1][2].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuCD142, His; Tissue Factor; TF; Coagulation Factor III; Thromboplastin; CD142; F3

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P13726-1

  • Expression Region

    G34-E251

  • AA Sequence

    GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREHHHHHH

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    35-55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Coagulation factor III, also known as tissue factor (TF), plays a crucial role in the extrinsic pathway of the coagulation cascade, initiating blood clotting upon vascular injury. The research surrounding recombinant tissue factor (rTF) has gained significant momentum due to its potential applications in both therapeutic and diagnostic realms. Historically, TF was found to be a key regulator of hemostasis, but its overexpression is also linked to pathological conditions, including thrombosis and cancer metastasis. Consequently, understanding the structure and function of rTF has important implications for designing targeted therapies that can modulate coagulation processes. Advances in recombinant DNA technology have made it possible to produce high-purity rTF, facilitating studies on its biochemical properties and cellular interactions. Furthermore, rTF is being investigated for its utility in enhancing coagulation in patients with bleeding disorders, as well as its role as a pro-coagulant factor in tumor biology. By elucidating the mechanisms underlying TF function and its recombinant forms, researchers aim to unravel novel therapeutic strategies that can balance coagulation and prevent undesired thrombotic events. The ongoing studies on Coagulation factor III/F3 recombinant protein not only contribute to our fundamental understanding of hemostatic processes but also pave the way for innovative treatments that address critical health challenges.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US