Cat: IPD-X15625

Recombinant Human Nectin-2/CD112 Protein(HEK293)

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Nectin-2/CD112

  • 简介

    Nectin-2/CD112 protein has dual roles in T-cell signaling: as a costimulator with CD226, promoting proliferation and cytokine production, and as a coinhibitor with PVRIG, inhibiting proliferation. It also acts as a cell adhesion protein and a receptor for certain viruses. Nectin-2/CD112 Protein, Human (HEK293) is the recombinant human-derived Nectin-2/CD112 protein, expressed by HEK293 , with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1.Measured by its binding ability in a functional ELISA. Immobilized Human CD112 at 0.5 μg/mL (100 μL/well) can bind Biotinylated Human DNAM-1. The ED50 for this effect is 0.6317 μg/mL, corresponding to a specific activity is 1.58×103 Unit/mg. 2.Immobilized Human Nectin-2, No Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Human PVRIG, mFc Tag with the ECsub>50 of ≤0.19 μg/mL determined by ELISA. Measured by its binding ability in a functional ELISA. Immobilized Human CD112 at 0.5 μg/mL (100 μL/well) can bind Biotinylated Human DNAM-1. The ED50 for this effect is 0.6317 μg/mL, corresponding to a specific activity is 1.58×103 Unit/mg.

  • Alternative Names

    Nectin-2; CD112; NECTIN2; PVRL2; HVEB; PRR2

  • Species

    Human

  • Source

    HEK293

  • Tag

    Tag Free

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    Q92692-2

  • Expression Region

    Q32-L360

  • AA Sequence

    QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    45-55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Nectin-2, also known as CD112, is a member of the Nectin family, which comprises immunoglobulin-like cell adhesion molecules. It plays a crucial role in cellular interactions, including cell adhesion and migration, and is involved in various physiological and pathological processes, such as immune response and tumor progression. The expression of Nectin-2 has been observed in multiple types of tumors, where it facilitates immune evasion by interacting with the DNAM-1 receptor on natural killer (NK) cells and T cells, thereby inhibiting their cytotoxic functions. Consequently, Nectin-2 has garnered attention as a potential target for cancer immunotherapy. Researchers are focused on the development of recombinant Nectin-2/CD112 proteins to better understand its biological functions and to create therapeutic strategies that can block its immunosuppressive effects. These recombinant proteins can also be utilized in the study of Nectin-2's role in tumor biology, as well as in the development of Nectin-2-targeted therapies, such as monoclonal antibodies or fusion proteins. By elucidating the mechanisms by which Nectin-2 modulates immune responses, scientists aim to enhance the effectiveness of cancer immunotherapies and improve patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US