Analytical Data
-
Gene name
CD177
- Application
-
Alternative Names
rHuCD177, His; CD177 Antigen; Human Neutrophil Alloantigen 2a; HNA-2a; NB1 Glycoprotein; NB1 GP; Polycythemia Rubra Vera Protein 1; CD177; NB1; PRV1
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
AAH29167.1
-
Expression Region
L22-G407
-
AA Sequence
LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGTTHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGHHHHHH
-
Protein Length
Partial
-
Molecular Weight
51-55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD177, also known as neutrophil antigen 1 (NA1), is a glycoprotein predominantly expressed on the surface of human neutrophils and plays a crucial role in the immune response. It is involved in various physiological processes, including the regulation of neutrophil adhesion, migration, and the generation of reactive oxygen species. CD177 is also significant in the context of transfusion medicine and autoimmune diseases, as it is a major target for the production of antibodies in certain conditions. Research has increasingly focused on the recombinant production of CD177 protein to better understand its functional properties and interactions with other immune components. Recombinant CD177 proteins can be used in various applications, including the development of diagnostic tools, therapeutic agents, and studying the biology of neutrophils under both healthy and pathological states. Recent advances in protein engineering techniques have enhanced the yield and functionality of recombinant CD177, facilitating its inclusion in studies aimed at elucidating its role in inflammation, host defense mechanisms, and potential implications in conditions like vasculitis and chronic inflammatory diseases. As such, the exploration of CD177 recombinant protein is essential for translating basic immunology into clinical applications, providing insights into neutrophil-related disorders, and paving the way for novel immunotherapies.











