Cat: IPD-X17176

Recombinant Mouse CD157 Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD157

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rMuCD157, His; ADP-ribosyl cyclase; ADP-ribosyl cyclase 2; Bone marrow stromal antigen 1; BST1; Cyclic ADP-ribose hydrolase 2; CD157

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q64277

  • Expression Region

    A25-E285

  • AA Sequence

    ARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRREHHHHHH

  • Protein Length

    Partial

  • Molecular Weight

    35-45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD157, also known as bone marrow stromal antigen 1 (BSA-1), is a member of the NAD+-glycohydrolase family and is primarily expressed on the surface of various immune cells, including monocytes and lymphocytes. It plays a significant role in modulating immune responses, promoting cell adhesion, and influencing cellular signaling pathways. The interest in CD157 has surged in recent years due to its involvement in immune regulation and potential implications in various diseases, including cancer, autoimmune disorders, and chronic inflammatory conditions. Recombinant CD157 protein has emerged as a valuable tool for researchers to study its functional roles and interactions within the immune system. By creating a purified form of this protein, scientists can perform in-depth analyses of its enzymatic activities, receptor interactions, and potential therapeutic applications. This research aims to elucidate the intricate mechanisms by which CD157 modulates immune responses and to explore its potential as a target for novel immunotherapies. Understanding the structure and function of CD157 can lead to innovative strategies for manipulative interventions in diseases exacerbated by immune dysregulation, thereby highlighting its importance in the field of immunology and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US