Cat: IPD-X15565

Recombinant Mouse CD74 Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD74

  • 简介

    The CD74 protein is significantly expressed in the thymus and lymph nodes, suggesting that it plays a key role in regulating immune system function. Its presence in the thymus, a key site for T cell development, underscores its important role in overseeing key cellular processes required for immune maturation. CD74 Protein, Mouse (224a.a, HEK293, His) is the recombinant mouse-derived CD74 protein, expressed by HEK293 , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CD74; Ii; DHLAG; HLADG; Ia-GAMMA; p33; CLIP; INVG34; Ia-GAMMA ; II

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    N-8*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P04441-1

  • Expression Region

    Q56-L279

  • AA Sequence

    QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    40-55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD74, also known as the invariant chain, is a membrane protein that plays a critical role in the immune response by facilitating the presentation of antigens to T cells. It serves as a chaperone for Major Histocompatibility Complex (MHC) class II molecules during their synthesis and transport within antigen-presenting cells. In recent years, research has highlighted the multifaceted functions of CD74 beyond its traditional role in immune signaling, including its involvement in cell proliferation, survival, and migration in various pathologies such as cancer and autoimmune diseases. Given its increased expression in several tumors, CD74 has garnered attention as a potential therapeutic target and a biomarker for disease progression. The production of recombinant CD74 proteins allows for detailed studies into its structural and functional properties, as well as its interactions with various ligands and receptors. This biochemical characterization is essential for understanding its role in immune regulation and pathology, thereby paving the way for the development of novel immunotherapeutic strategies. The ongoing exploration of CD74 in both normal physiology and disease states underscores its importance in immunology and highlights its potential as a target for innovative therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US