Cat: IPD-X17154

Recombinant Human CD131 Protein(HEK293) , hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD131

  • 简介

    The EPOR Protein functions as a receptor for erythropoietin, mediating erythroblast proliferation and differentiation upon EPO stimulation. The heterodimer triggers the JAK2/STAT5 signaling cascade and, in certain cell types, activates STAT1, STAT3, and the LYN tyrosine kinase. Additionally, isoform EPOR-T acts as a dominant-negative receptor, modulating EPOR-mediated signaling pathways. EPOR-CD131 Heterodimer Protein, Human (HEK293, Fc) is a recombinant protein dimer complex containing human-derived EPOR-CD131 Heterodimer protein, expressed by HEK293 , with C-hFc labeled tag. EPOR-CD131 Heterodimer Protein, Human (HEK293, Fc), has molecular weight of ~110-130 kDa.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Human EPOR at 2μg/mL (100μL/well) can bind biotinylated EPO. The ED50 for this effect is 44.91ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Human EPOR at 2 μg/mL (100 μL/well) can bind biotinylated EPO. The ED50 for this effect is 44.91 ng/mL.

  • Alternative Names

    EpoR; EPO-R; Erythropoietin R; Erythropoietin receptor

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    P19235 (A25-P250)&P32927

  • Expression Region

    P19235 (A25-P250)&P32927 (W17-W443)

  • AA Sequence

    MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP&WERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPGDEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTESVLPMW

  • Molecular Weight

    110-130 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD131, also known as the common beta chain (CD131), is a crucial component of the receptor complex for several cytokines, including interleukin-3 (IL-3), IL-5, and granulocyte-macrophage colony-stimulating factor (GM-CSF). These cytokines play significant roles in hematopoiesis, cellular differentiation, and immune responses. The study of CD131 recombinant proteins has gained attention due to their potential applications in therapeutic interventions for various diseases, including hematological disorders, immune system dysfunctions, and inflammatory conditions. Variations or mutations in CD131 can lead to altered signaling pathways, contributing to diseases such as asthma and chronic granulomatous disease. Understanding the structure and function of CD131 through recombinant proteins can provide insights into its role in cell signaling and immune regulation. Moreover, such research can facilitate the development of novel therapeutic agents that target CD131 or its associated pathways, offering new avenues for treating diseases linked to cytokine signaling dysregulation. The evaluation of CD131 recombinant proteins also enhances our understanding of receptor interactions and the mechanisms underlying cytokine-mediated cellular responses, paving the way for improved treatments in immunotherapy and regenerative medicine. Overall, the investigation of CD131 and its recombinant forms represents a promising field with significant implications for enhancing our understanding of immune kinetics and developing targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US