Analytical Data
-
Gene name
CD68
-
简介
CD68 is a protein belonging to the LAMP (lysosome-associated membrane protein) family. It is expressed primarily in macrophages, monocytes, and dendritic cells, serving as a marker for these immune cells. CD68 Protein, Rat (HEK293, His) is the recombinant rat-derived CD68 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Rat S100A8 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Rat CD68 Protein. The ED50 for this effect is 9.492 μg/mL. Measured by its binding ability in a functional ELISA. When Recombinant Rat S100A8 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Rat CD68 Protein. The ED50 for this effect is 9.492 μg/mL.
-
Alternative Names
CD68 antigenmacrophage antigen CD68; CD68; Gp110; Macrosialin; SRD1
-
Species
Rat
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
Q4FZY1
-
Expression Region
K20-S295
-
AA Sequence
KDCPHKKAATLLPSFTETPTTTGSTASPTTTHRPTTTSHRPTTTSHRPTTTSHRPTTTSHRPTTTSHRPTTTSHGNATVSPTTNSPGFSTVGPHPGPPPPSPSPSPSSTGALGNYTWTNGSQPCVQLQAQIQIRILYLTQGGKKAWGLSVLNPNKTKVQGGCDSAHPHLALSFPYGQLTFGFKQDRHQSHSTVYLNYMAVEYNVSFPQAAQWTFSAQNSSLQELQAPLGQSFCCGNTSIVLSPAIHLDLLSLRLQAAQLPDKGHFGPCFSCASDQS
-
Protein Length
Partial
-
Molecular Weight
60-110 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD68 is a glycoprotein predominantly expressed in the membranes of macrophages and other myeloid cells, serving as a vital marker for monocyte and macrophage differentiation. It is involved in various immune responses, including phagocytosis, antigen presentation, and modulation of inflammatory processes. Due to its role in immune system function, CD68 has garnered significant interest in research related to various diseases, including cancer, atherosclerosis, and autoimmune disorders. The study of recombinant CD68 proteins is pivotal for understanding its biological functions and mechanisms, as well as for developing potential therapeutic applications. By producing and characterizing CD68 recombinant proteins, researchers can investigate interactions with ligands, receptor signaling pathways, and the protein’s role in macrophage activation. These studies can lead to novel insights into the immune response and identify new targets for therapeutic intervention in diseases characterized by dysregulated macrophage activity. Overall, the exploration of CD68 recombinant proteins represents a crucial area of research in immunology, providing a foundation for advancements in both basic science and clinical applications.
