Cat: IPD-X15328

Recombinant Human JAM-B/CD322 Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    JAM-B/CD322

  • 简介

    JAM-B/CD322 protein and JAM3 coordinate heterotypic cell interactions and regulate different processes. In the bone marrow, it retains hematopoietic stem cells on stromal cells and aids leukocyte extravasation by promoting transmigration, tethering, and rolling. JAM-B/CD322 Protein, Human (HEK293, His) is the recombinant human-derived JAM-B/CD322 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuJunctional adhesion molecule B/JAM-B, His; Junctional Adhesion Molecule B; JAM-B; Junctional Adhesion Molecule 2; JAM-2; Vascular Endothelial Junction-Associated Molecule; VE-JAM; CD322; JAM2; C21orf43; VEJAM

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P57087-1

  • Expression Region

    F29-N236

  • AA Sequence

    FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLN

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    35-39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

JAM-B (Junctional Adhesion Molecule B) is a member of the immunoglobulin superfamily and plays a critical role in cell adhesion and tight junction formation, particularly in endothelial and epithelial cells. Research has increasingly focused on JAM-B due to its involvement in various physiological and pathological processes, including inflammation, immune responses, and tumor metastasis. Another critical protein, CD322, is often identified as a receptor for JAM-B, facilitating intercellular communication and influencing leukocyte migration. The reconstitution of JAM-B/CD322 recombinant proteins aims to elucidate their structure-function relationships and understand their roles in cellular interactions and signaling pathways. This research holds potential implications for therapeutic strategies targeting inflammatory diseases and cancer, as modulation of JAM-B/CD322 interactions may alter disease progression or enhance tissue repair mechanisms. Overall, the study of JAM-B/CD322 recombinant proteins contributes to a greater understanding of cell adhesion mechanisms in health and disease, paving the way for novel biomedical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US