Cat: IPD-X15272

Recombinant Human IL-1R1 Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-1R1

  • 简介

    IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM)[1]. IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB and MAPK pathway[4]. IL-1R1 Protein, Human (HEK293, His) is a recombinant human extracellular region of IL-1R1 (L18-T332) with a C-Terminal 6*His tag, which is produced in HEK293 cells.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to inhibit IL-1 beta -dependent proliferation in CTLL-2 cells. Under the action of 30 pg/mL recombinant human IL-1β. The ED50 for this effect is 1.286 μg/mL, corresponding to a specific activity is 7.776×10^2 units/mg. Measured by its ability to inhibit IL-1 beta -dependent proliferation in CTLL-2 cells. Under the action of 30 pg/mL recombinant human IL-1β, The ED50 for this effect is 1.286 μg/mL, corresponding to a specific activity is 7.776×102 units/mg.

  • Alternative Names

    Interleukin-1 receptor type 1; IL-1R-1; IL-1RT-1; Interleukin-1 receptor alpha; IL-1R-alpha; p80; CD121a

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    P14778

  • Expression Region

    L18-T332

  • AA Sequence

    LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    45-62 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-1 receptor type 1 (IL-1R1) is a crucial component of the immune response, serving as the primary signaling receptor for interleukin-1 (IL-1), a pro-inflammatory cytokine involved in various physiological and pathological processes. The study of IL-1R1 has gained significant attention due to its role in mediating immune responses, particularly in inflammatory diseases, autoimmune disorders, and certain cancers. Dysregulation of IL-1R1 signaling has been linked to a range of health issues, making it a promising target for therapeutic interventions. Research in this area has focused on understanding the structural and functional dynamics of IL-1R1, the mechanisms by which it influences downstream signaling pathways, and its interactions with other proteins. Recombinant IL-1R1 protein plays a vital role in these studies, allowing for detailed investigations of the receptor's function, ligand binding characteristics, and potential modulation by small molecules or antibodies. Moreover, IL-1R1 recombinant proteins are also being developed for use in diagnostic kits and therapeutic strategies aimed at controlling inappropriate inflammatory responses. Overall, the ongoing research surrounding IL-1R1 recombinant protein is essential for advancing our understanding of immune regulation and developing effective treatments for a variety of inflammatory and autoimmune conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US