Analytical Data
-
Gene name
FGFR-1 alpha (IIIb)
-
简介
FGFR-1 alpha, a conserved member of the FGFR family, binds acidic and basic fibroblast growth factors, influencing mitogenesis and differentiation. Mutations in FGFR1 cause syndromes and disorders. It exhibits ubiquitous expression, with notable levels in ovary (RPKM 21.8), fat (RPKM 21.4), and 25 other tissues. Alternatively spliced variants contribute to its functional diversity. FGFR-1 alpha (IIIb) Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived FGFR-1 alpha, expressed by HEK293 , with C-His, C-10*His labeled tag. FGFR-1 alpha (IIIb) Protein, Human (HEK293, His), has molecular weight of 60-90 kDa.
- Application
-
Biological Activity
Measured by its ability to inhibit FGF acidic-dependent proliferation of NIH/3T3 mouse fibroblast cells. The ED50 for this effect is 4.134 ng/mL, corresponding to a specific activity is 2.42×10^5 units/mg. Measured by its ability to inhibit FGF acidic-dependent proliferation of NIH/3T3 mouse fibroblast cells. The ED50 for this effect is 4.134 ng/mL, corresponding to a specific activity is 2.42×105 units/mg.
-
Alternative Names
Fibroblast growth factor receptor 2; FGFR-2; FGF R2a; FGFR2 alpha
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11362-7
-
Expression Region
P11362-7/NP_056934.2 (R22-K310&A359-E374)&AAB19502 (H1-P47)
-
AA Sequence
A1: RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILK A2: ALEERPAVMTSPLYLE A3: HSGINSSDAEVLTLFNVTEAQSGEYVCKVSNYIGEANQSAWLTVTRP
-
Molecular Weight
60-90 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fibroblast growth factor receptors (FGFRs) play a critical role in various cellular processes, including proliferation, differentiation, and survival. Among the family of FGFRs, FGFR-1 has several isoforms, with FGFR-1 alpha (IIIb) being particularly significant in developmental biology and oncogenesis. This isoform is primarily expressed in mesenchymal tissues and plays a crucial role in mediating the effects of fibroblast growth factors (FGFs) during embryonic development and tissue repair. Aberrant signaling of FGFR-1 alpha (IIIb) has been implicated in various cancers, making it a potential target for therapeutic intervention. Research into recombinant FGFR-1 alpha (IIIb) proteins has gained momentum as scientists aim to understand its structural and functional properties to develop specific inhibitors. By producing recombinant FGFR-1 alpha (IIIb), researchers can investigate its binding affinities, downstream signaling pathways, and interactions with various FGFs, providing insights that are essential for drug design and therapeutic strategies. Furthermore, the study of this recombinant protein has significant implications not only for cancer treatment but also for regenerative medicine, as it may aid in enhancing tissue repair mechanisms. Overall, the investigation of FGFR-1 alpha (IIIb) is crucial for comprehending the molecular underpinnings of diseases associated with its dysregulation and for exploring novel approaches in targeted therapy.
