Cat: IPD-X15128

Recombinant Human CD276/B7-H3 (4Ig)/B7-H3b Protein(HEK293) , hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD276/B7-H3 (4Ig)/B7-H3b

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuB7-H3/ICOSLG, Fc Chimera; B7H3; B7 homolog 3; CD276

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5ZPR3-2

  • Expression Region

    L29-P245

  • AA Sequence

    HLEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP

  • Protein Length

    Partial

  • Molecular Weight

    62-65 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD276, also known as B7-H3, is an immune checkpoint protein belonging to the B7 family and plays a significant role in regulating immune responses. It is characterized by its four immunoglobulin-like domains (4Ig) and has been implicated in various types of cancers, contributing to tumor immune evasion. Research has shown that CD276 can inhibit T-cell activation and promote an immunosuppressive environment, making it a potential target for cancer immunotherapy. The B7-H3b isoform, a variant of B7-H3, has distinct biological functions and may exhibit different expression patterns across tissues and tumors. The study of recombinant CD276/B7-H3 (4Ig)/B7-H3b proteins is crucial for understanding their structural characteristics, functional roles, and mechanisms of action in the immune system. By exploring their interactions with immune cells and potential therapeutic applications, researchers aim to develop innovative strategies to enhance anti-tumor immunity and improve cancer treatment outcomes. The recombinant proteins serve as valuable tools for further investigation into the biology of CD276, helping to elucidate their contributions to tumor progression and immune regulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US