Cat: IPD-X15107

Recombinant Human B7-H2/ICOSLG Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    B7-H2/ICOSLG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuB7-H2/ICOSLG, His; B7 homolog 2; B7RP-1; CD275

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75144-1

  • Expression Region

    D19-S258

  • AA Sequence

    DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    45-55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

B7-H2 (also known as ICOSLG) is a crucial co-stimulatory molecule involved in immune regulation, particularly in the activation and differentiation of T cells. It interacts with the Inducible T-cell Co-stimulator (ICOS), which is predominantly expressed on activated T cells. This interaction plays a significant role in enhancing T cell responses, including cytokine production and promoting immunological memory. Understanding the B7-H2/ICOSLG pathway has garnered attention due to its implications in various disease contexts, including chronic infections, autoimmune disorders, and cancer. The expression levels and functional activity of B7-H2 can influence the efficacy of immune responses, making it a potential target for therapeutic intervention. Researchers have sought to develop recombinant B7-H2 proteins to study their biological functions, enhance our understanding of T cell regulation, and explore their potential use in immunotherapy. By generating soluble or fusion forms of this protein, scientists aim to elucidate its signaling mechanisms and interactions with other immune checkpoints. Additionally, the study of B7-H2/ICOSLG may offer new avenues for enhancing vaccine responses or overcoming immune evasion by tumors, providing meaningful insights into the design of novel immunotherapeutic strategies. Overall, the investigation of B7-H2/ICOSLG recombinant proteins has the potential to contribute to the development of innovative treatments for various immune-mediated conditions and to advance our understanding of T cell biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US