Cat: IPD-X15073

Recombinant Human 4-1BBL/TNFSF9 Trimer Protein , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    4-1BBL/TNFSF9 Trimer

  • 简介

    4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (His) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tumor necrosis factor ligand superfamily member 9; CD137L; 4-1BB Ligand

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P41273

  • Expression Region

    P52-E254

  • AA Sequence

    PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

  • Protein Length

    Extracellular Domain

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

4-1BBL (also known as TNFSF9) is a member of the TNF superfamily and plays a crucial role in immune regulation, particularly in T cell activation and proliferation. It is primarily expressed on antigen-presenting cells and binds to its receptor, 4-1BB (CD137), found on T cells, promoting their survival and enhancing immune responses. The therapeutic potential of targeting the 4-1BB/4-1BBL axis has garnered significant interest, particularly in cancer immunotherapy, as it can enhance the anti-tumor immune response. However, the use of 4-1BBL as a therapeutic agent has been limited by its stability and bioavailability in vivo. To address these challenges, researchers have been focusing on developing a recombinant 4-1BBL trimer, which is expected to enhance its functional activity and therapeutic efficacy by improving its interaction with the 4-1BB receptor. The trimeric form is anticipated to provide a more stable and potent stimulus for T cell activation compared to monomeric forms. This engineering approach is critical for harnessing the full potential of the 4-1BB/4-1BBL pathway in various therapeutic applications, including cancer treatment, where robust T cell activation is essential for effective tumor eradication. Thus, the study of recombinant 4-1BBL trimers is positioned at the forefront of immunotherapy research, aiming to create innovative solutions for enhancing immune responses against malignancies and potentially other diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US