Cat: IPD-X14992

Recombinant Mouse CD55/DAF Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD55/DAF

  • 简介

    The CD55/DAF protein is critical in the immune system and recognizes C4b and C3b fragments. It interacts with cell-associated C4b and C3b, interfering with their enzymatic conversion and preventing the formation of complement cascade amplifying convertase. CD55/DAF Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD55/DAF protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Complement Decay-Accelerating factor; CD55; CR; DAF

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q61475

  • Expression Region

    D35-T361

  • AA Sequence

    MIRGRAPRTRPSPPPPLLPLLSLSLLLLSPTVRGDCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVSATQHVPVTKTTVRHPIRTSTDKGEPNT

  • Protein Length

    Partial

  • Molecular Weight

    60 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD55, also known as decay-accelerating factor (DAF), is a critical regulator of the complement system, playing a vital role in protecting host cells from complement-mediated lysis. It acts by accelerating the decay of C3 and C5 convertases, thus inhibiting the amplification of the complement cascade. The dysregulation of CD55/DAF has been implicated in various pathological conditions, including autoimmune diseases, organ transplantation, and cancer. For instance, tumors often exploit CD55 to evade immune surveillance, leading to tumor progression and poor patient outcomes. Given its pivotal role in immune regulation, recombinant CD55/DAF proteins have become a focal point of research, with potential therapeutic applications targeting complement-related diseases and enhancing the efficacy of cancer immunotherapies. Recent studies have focused on the production, characterization, and functional evaluation of recombinant CD55 proteins, aiming to elucidate their mechanisms of action and therapeutic potential. Advances in recombinant DNA technology and protein engineering have facilitated the generation of active CD55 variants, which can be coupled with various delivery systems for targeted therapy. This research not only contributes to a better understanding of the complement system but also opens new avenues for developing innovative treatments that leverage the protective properties of CD55/DAF against various diseases. Overall, the study of CD55/DAF as a recombinant protein holds promise for enhancing therapeutic strategies in immunology and oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US