Analytical Data
-
Gene name
TLR4
-
简介
TLR4 is a transmembrane receptor that recognizes PAMPs and DAMPs and cooperates with LY96 for LPS detection. TLR4 activates MYD88-dependent and independent signaling pathways and participates in TIRAP, TRAF6 and CD14-mediated endocytosis. TLR4 Protein, Human (sf9, His, Solution) is the recombinant human-derived TLR4 protein, expressed by Sf9 insect cells, with C-His labeled tag.
- Application
-
Alternative Names
CD284; hToll; TLR-4; Toll like receptor 4 protein; TOLL
-
Species
Human
-
Source
Baculovirus
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00206-1
-
Expression Region
E24-K631
-
AA Sequence
ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK
-
Protein Length
Partial
-
Molecular Weight
68 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Toll-like receptor 4 (TLR4) plays a crucial role in the innate immune response by recognizing pathogen-associated molecular patterns, particularly lipopolysaccharides (LPS) from gram-negative bacteria. The study of TLR4 recombinant proteins has gained significant attention due to their potential in vaccine development, immunotherapy, and understanding immune system mechanisms. Given that TLR4 signaling is fundamental in mediating inflammatory responses, researchers are keen to explore the receptor's structure and function via recombinant technology. Producing TLR4 as a recombinant protein allows for detailed investigations into its binding interactions, signaling pathways, and downstream effects. It also promotes the development of novel therapeutic strategies to modulate immune responses in various diseases, including sepsis, autoimmune disorders, and cancer. Furthermore, TLR4's involvement in the pathogenesis of metabolic conditions, such as obesity and diabetes, underscores the importance of elucidating its functional properties. Overall, continued research on TLR4 recombinant proteins represents a promising avenue for advancing our understanding of immune regulation and for developing new immunotherapeutic interventions.











