Cat: IPD-X16788

Recombinant Rat IL-18R alpha Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-18R alpha

  • 简介

    IL-18R alpha (interleukin-18 receptor alpha) is an interleukin receptor of the immunoglobulin superfamily. IL-18 forms a signalling complex with the IL-18 receptor α (Rα) and β (Rβ) chains at the plasma membrane, which induces multiple inflammatory cytokines[1]. IL-18R complex recruits the IL-1R- activating kinase and TNF- associated factor 6, which phosphorylates nuclear factor kβ- inducing kinase, with subsequent activation of nuclear factor kβ[2]. IL-18R alpha inhibits the production of IFN-γ stimulated with the combination of rhIL-2 and rhIL-18[3]. IL-18R alpha Protein, Rat (HEK293, His) is a recombinant protein with a His label that consists of 326 amino acids (M1-G326) and is produced by HEK293 cells.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-18R alpha Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Mouse IL-18 Protein. The ED50 for this effect is 1.3 μg/mL. Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-18R alpha Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Mouse IL-18 Protein. The ED50 for this effect is 1.3 μg/mL.

  • Alternative Names

    Interleukin-18 receptor 1; IL-18R1; CDw218a; IL1RRP; IL-18R-alpha; CD218a

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    A0A8I6A1C2

  • Expression Region

    A18-G326

  • AA Sequence

    APKSCIRRSQIHVVEGEPFYLKPCDMSAPMHNNETATMRWFKGNASHGYRELNMRSSPRIAFHGHALEFWPVELEDKGTYFSQVGNDRQNWTLNVTKRNKHSCFSEKLVTNRDVEVKKSLWITCENPSYGELINHTLLYKNCKEISKTPMILKDAEFGDEGYYSCVFSVHHNGQQYNITKTVNITVIEGNSKITPAIFGSKSAKVGVELGEDVELNCSAVLNRNDLFYWSIRKEDSLDPNVHEDRNETTWTFEGKLHASKILRIQKVTEKYLNVLYNCTVANEEATDTKSFILVRKETPDIQGHVFMRG

  • Protein Length

    Partial

  • Molecular Weight

    55-75 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-18 receptor alpha (IL-18Rα) is a critical component of the IL-18 signaling pathway, which plays a vital role in the immune response, particularly in the activation of T cells and natural killer (NK) cells. Studies have shown that IL-18, a pro-inflammatory cytokine, is involved in various autoimmune diseases, infectious diseases, and cancer progression. The receptor complex, comprising IL-18Rα and IL-18Rβ, facilitates the binding of IL-18 and initiates downstream signaling pathways that lead to the production of other cytokines, enhancing the immune response. Given its pivotal role in modulating inflammation and immune responses, IL-18Rα has emerged as a potential therapeutic target for treating various diseases. Researchers are focusing on the production of recombinant IL-18Rα protein to study its structure, function, and interaction with IL-18, as well as to explore its role in disease pathology. Additionally, the recombinant protein can serve as a valuable tool for developing inhibitors or antagonists that could block IL-18 signaling, offering new avenues for therapeutic interventions in diseases characterized by excessive inflammation or immune dysregulation. Understanding the dynamics and mechanisms of IL-18Rα will not only enhance our knowledge of immune regulation but may also lead to novel strategies for the treatment of conditions such as chronic inflammatory diseases and cancers, where modulation of the immune response is crucial. This ongoing research underscores the importance of IL-18Rα in immunology and its potential implications in clinical therapy.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US