Analytical Data
-
Gene name
TNF RII/TNFRSF1B
-
简介
The TNFRII protein is a receptor with high affinity for TNFSF2/TNF-α and low affinity for TNFSF1/lymphotoxin-α, and plays a key role in mediating the metabolic effects of TNF-α. The TRAF1/TRAF2 complex recruits BIRC2 and BIRC3 to TNFRSF1B/TNFR2 to regulate the apoptotic pathway. TNFRII Protein, Human (183a.a) is the recombinant human-derived TNFRII protein, expressed by E. coli , with tag free.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20333-1
-
Expression Region
P24-T206
-
AA Sequence
PAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT
-
Protein Length
Partial
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Tumor Necrosis Factor Receptor II (TNF RII, also known as TNFRSF1B) is a crucial receptor in the tumor necrosis factor (TNF) signaling pathway, playing a significant role in modulating inflammation and immune responses. Its involvement in various physiological and pathological processes, including immune regulation, cell survival, and apoptosis, has garnered considerable interest in the field of biomedical research. Dysregulation of TNF signaling has been linked to multiple diseases, particularly autoimmune disorders and cancer. Consequently, TNF RII serves as a potential therapeutic target for drug development. Researchers have been focusing on the recombination and expression of TNF RII to better understand its structure-function relationship and to explore its therapeutic potential. By generating recombinant TNF RII proteins, scientists can elucidate the receptor's biochemical characteristics, interaction with ligands, and downstream signaling mechanisms. Furthermore, these recombinant proteins can be utilized in biological assays to discover novel inhibitors or agonists, leading to innovative treatment strategies for related ailments. The growing body of research surrounding TNF RII emphasizes its significance in drug discovery and therapeutic intervention, making it a pivotal focus in the quest for novel approaches to modulate immune responses and combat diseases driven by TNF signaling dysregulation.











