Cat: IPD-X14675

Recombinant Rat TNFRSF1A Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNFRSF1A

  • 简介

    TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-κB, mediate apoptosis, and function as a regulator of inflammation. TNFRSF1A Protein, Rat (HEK293, His) is expressed by HEK293 and has a transmembrane region (M1-A211) with a His tag at the C-terminus[1].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tumor necrosis factor receptor superfamily member 1A; CD120a; TNF-R1; TNFRSF1A

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P22934

  • Expression Region

    L30-A211

  • AA Sequence

    LVPSLGDREKRDNLCPQGKYAHPKNNSICCTKCHKGTYLVSDCPSPGQETVCEVCDKGTFTASQNHVRQCLSCKTCRKEMFQVEISPCKADMDTVCGCKKNQFQRYLSETHFQCVDCSPCFNGTVTIPCKEKQNTVCNCHAGFFLSGNECTPCSHCKKNQECMKLCLPPVANVTNPQDSGTA

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    30-40 kDa due to glycosylation

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TNFRSF1A, also known as Tumor Necrosis Factor Receptor Superfamily Member 1A, is a crucial receptor involved in the regulation of immune responses and apoptosis. As the primary receptor for tumor necrosis factor (TNF), it plays a pivotal role in mediating inflammatory responses and has been implicated in various diseases, including autoimmune disorders, cancer, and neurodegenerative diseases. Research into TNFRSF1A recombinant proteins has gained significant attention due to their potential therapeutic applications. By studying these proteins, scientists aim to elucidate the signaling pathways activated by TNF and understand how dysregulation of these pathways contributes to disease pathology. Recombinant TNFRSF1A can be utilized to develop targeted therapies that modulate TNF interactions, offering promising avenues for treating conditions such as rheumatoid arthritis and inflammatory bowel disease. Furthermore, the exploration of TNFRSF1A's structural and functional properties through recombinant expression provides insights into its role in cell signaling and the development of novel biopharmaceuticals. Overall, the scientific investigation of TNFRSF1A recombinant proteins is critical for advancing our understanding of TNF-mediated mechanisms and improving therapeutic strategies for a range of inflammatory diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US