Analytical Data
-
Gene name
TNFRSF1A
-
简介
TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-κB, mediate apoptosis, and function as a regulator of inflammation. TNFRSF1A Protein, Rat (HEK293, His) is expressed by HEK293 and has a transmembrane region (M1-A211) with a His tag at the C-terminus[1].
- Application
-
Alternative Names
Tumor necrosis factor receptor superfamily member 1A; CD120a; TNF-R1; TNFRSF1A
-
Species
Rat
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22934
-
Expression Region
L30-A211
-
AA Sequence
LVPSLGDREKRDNLCPQGKYAHPKNNSICCTKCHKGTYLVSDCPSPGQETVCEVCDKGTFTASQNHVRQCLSCKTCRKEMFQVEISPCKADMDTVCGCKKNQFQRYLSETHFQCVDCSPCFNGTVTIPCKEKQNTVCNCHAGFFLSGNECTPCSHCKKNQECMKLCLPPVANVTNPQDSGTA
-
Protein Length
Extracellular Domain
-
Molecular Weight
30-40 kDa due to glycosylation
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFRSF1A, also known as Tumor Necrosis Factor Receptor Superfamily Member 1A, is a crucial receptor involved in the regulation of immune responses and apoptosis. As the primary receptor for tumor necrosis factor (TNF), it plays a pivotal role in mediating inflammatory responses and has been implicated in various diseases, including autoimmune disorders, cancer, and neurodegenerative diseases. Research into TNFRSF1A recombinant proteins has gained significant attention due to their potential therapeutic applications. By studying these proteins, scientists aim to elucidate the signaling pathways activated by TNF and understand how dysregulation of these pathways contributes to disease pathology. Recombinant TNFRSF1A can be utilized to develop targeted therapies that modulate TNF interactions, offering promising avenues for treating conditions such as rheumatoid arthritis and inflammatory bowel disease. Furthermore, the exploration of TNFRSF1A's structural and functional properties through recombinant expression provides insights into its role in cell signaling and the development of novel biopharmaceuticals. Overall, the scientific investigation of TNFRSF1A recombinant proteins is critical for advancing our understanding of TNF-mediated mechanisms and improving therapeutic strategies for a range of inflammatory diseases.











