Analytical Data
-
Gene name
TNFRSF1A
-
简介
TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-κB, mediate apoptosis, and function as a regulator of inflammation. TNFRSF1A Protein, Human (His) is expressed by E. coli and has a transmembrane region (I22-T211) with a 6*His tag at the N-terminus[1].
- Application
-
Biological Activity
1. Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929 mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin D.The ED50 for this effect is 0.07651 μg/mL in the presence of 0.25 ng/mL of recombinant humanTNF-alpha, corresponding to a specific activity is 1.307×104 units/mg. 2. Loaded Atrosab (HY-P990008) on AHC2 biosensor, can bind TNFRSF1A Protein, Human (His) with an affinity constant of 1.151E-08 M as determined in BLI assay. Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929 mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin D.The ED50 for this effect is 0.07651 μg/mL in the presence of 0.25 ng/mL of recombinant humanTNF-alpha, corresponding to a specific activity is 1.307×104 units/mg. Loaded Atrosab (HY-P990008) on AHC2 biosensor, can bind TNFRSF1A Protein, Human (His) with an affinity constant of 1.151E-08 M as determined in BLI assay.
-
Alternative Names
Tumor necrosis factor receptor superfamily member 1A; Tumor necrosis factor receptor 1; TNF-R1; Tumor necrosis factor receptor type I; TNF-RI; TNFR-I; TNFAR; TNFR1
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19438
-
Expression Region
I22-T211
-
AA Sequence
IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
-
Protein Length
Partial
-
Molecular Weight
22.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFRSF1A, also known as Tumor Necrosis Factor Receptor Superfamily Member 1A, is a crucial receptor involved in the regulation of immune responses and apoptosis. As the primary receptor for tumor necrosis factor (TNF), it plays a pivotal role in mediating inflammatory responses and has been implicated in various diseases, including autoimmune disorders, cancer, and neurodegenerative diseases. Research into TNFRSF1A recombinant proteins has gained significant attention due to their potential therapeutic applications. By studying these proteins, scientists aim to elucidate the signaling pathways activated by TNF and understand how dysregulation of these pathways contributes to disease pathology. Recombinant TNFRSF1A can be utilized to develop targeted therapies that modulate TNF interactions, offering promising avenues for treating conditions such as rheumatoid arthritis and inflammatory bowel disease. Furthermore, the exploration of TNFRSF1A's structural and functional properties through recombinant expression provides insights into its role in cell signaling and the development of novel biopharmaceuticals. Overall, the scientific investigation of TNFRSF1A recombinant proteins is critical for advancing our understanding of TNF-mediated mechanisms and improving therapeutic strategies for a range of inflammatory diseases.











