Cat: IPD-X16581

Recombinant Human CD162/PSGL-1 Protein(HEK293) , hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD162/PSGL-1

  • 简介

    CD162/PSGL-1 Protein, a cell surface receptor, plays a crucial role in leukocyte trafficking and adhesion. Dysregulation of CD162/PSGL-1 Protein has been associated with inflammatory diseases and impaired immune responses. Targeting CD162/PSGL-1 Protein may offer potential therapeutic interventions in these conditions by modulating leukocyte trafficking, enhancing immune responses, and managing inflammatory disorders. CD162/PSGL-1 Protein, Human (HEK293, hFc) is the recombinant human-derived CD162/PSGL-1 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    P-selectin glycoprotein ligand 1; PSGL-1; Selectin P ligand; CD162; SELPLG

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14242

  • Expression Region

    Q42-G295

  • AA Sequence

    QATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKG

  • Protein Length

    Partial

  • Molecular Weight

    100-130 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD162, also known as P-selectin glycoprotein ligand-1 (PSGL-1), is a key adhesion molecule predominantly expressed on leukocytes, playing a crucial role in the regulation of immune responses and inflammation. The interaction between CD162 on leukocytes and P-selectin on activated endothelial cells is essential for the adhesion and rolling of leukocytes, facilitating their migration to sites of injury or infection. Research into CD162/PSGL-1 has gained significant attention due to its implications in various pathological conditions, including autoimmune diseases, chronic inflammation, and cancer metastasis. Understanding the structural and functional aspects of this molecule could provide insights into therapeutic targets for modulating immune responses. Recombinant CD162/PSGL-1 proteins have been developed to study these interactions in vitro, enabling investigations into their role in leukocyte trafficking and functional assays. By using these recombinant proteins, researchers can explore the signaling pathways activated upon CD162 engagement, assess the effects of mutations or post-translational modifications, and evaluate potential inhibitors that may disrupt the CD162-P-selectin interaction, which is a promising strategy for developing novel anti-inflammatory therapies. Thus, the study of CD162/PSGL-1 not only enhances our understanding of cellular adhesion mechanisms but also opens avenues for targeted immunotherapy in various diseases characterized by dysregulated immune responses.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US