Analytical Data
-
Gene name
Tissue Factor
-
简介
F3 Protein, a cell surface receptor, plays a significant role in regulating blood coagulation and promoting cell adhesion. Dysregulation of F3 Protein has been associated with various disorders, including thrombosis and cancer. Targeting F3 Protein may offer potential therapeutic interventions in these conditions by inhibiting blood clot formation and preventing tumor cell adhesion and metastasis. Tissue Factor Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Tissue Factor protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Coagulation Factor III; Tissue Factor; TF; F3; CD142
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
A0A2K5VX02
-
Expression Region
S33-E252
-
AA Sequence
SGTTNTVAAYNLTWKSTNFKTILEWEPKPINQVYTVQISTKSGDWKSKCFYTADTECDLTDEIVKDVKQTYLARVFSYPAGHVESTGSTEEPPYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVQDEWTLVRRNDTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRRTANRKSTDSPVECMGHEKGESRE
-
Protein Length
Partial
-
Molecular Weight
34-50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Tissue Factor (TF), also known as thromboplastin, is a crucial membrane glycoprotein involved in the initiation of the coagulation cascade, playing a pivotal role in hemostasis and thrombosis. It acts as a receptor for factor VII/VIIa, facilitating the activation of the extrinsic pathway of coagulation. Research into TF has gained significant momentum due to its dual role in normal and pathological processes, including its contribution to cancer progression, inflammation, and vascular disorders. Elevated levels of TF have been associated with thrombosis in various diseases such as cancer, where it aids tumor growth and metastasis by promoting vascularization and enhancing the inflammatory response. Furthermore, TF has been implicated in acute coronary syndromes and sepsis, linking it to adverse clinical outcomes. The development of recombinant TF proteins has provided invaluable tools for elucidating its mechanisms of action and potential therapeutic applications. These recombinant proteins enable detailed studies of TF's role in coagulation and its interactions with other signaling pathways, paving the way for innovative strategies in thrombosis management and cancer therapy. Consequently, studying recombinant TF proteins not only enhances our understanding of hemostatic balance but also opens avenues for novel therapeutic interventions targeting TF in various diseases.











