Analytical Data
-
Gene name
IL-12 beta
-
简介
IL-12 beta Protein, also known as natural killer cell stimulatory factor 2, is a common subunit (p40) of IL-12 and IL-23. IL-12 is a inflammatory factor expressed by activated macrophages, and involves in Th1-type immune response against cancer[1]. IL-12 beta Protein located outside the cell membrane, involves in singalling mediated by Jak-STAT[3]. IL-12 beta Protein consists of 335 amino acids (M1-N328) with a fibronectin type-III domain (233-324 a.a). IL-12 beta Protein, Marmoset is produced in HEK293 cells with a C-Terminal hFc-tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Human IL-12R beta 1 is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Marmoset IL-12 beta Protein. The ED50 for this effect is 0.5066 μg/mL. Measured by its binding ability in a functional ELISA. When Recombinant Human IL-12R beta 1 is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Marmoset IL-12 beta Protein. The ED50 for this effect is 0.5066 μg/mL.
-
Alternative Names
Interleukin-12 subunit beta; IL-12B; CLMF p40; IL-12 subunit p40; NKSF2; IL12B
-
Species
Marmoset
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.
-
Uniprot
F7IQ84
-
Expression Region
I23-N328
-
AA Sequence
IWELKKDVYVIELDWYLDAPGEMVVITCDTPEEDGITWTLEESSEVLGSGKNLTIQVKEFGDAGQYTCHKGGEALSHLLLLLHKKEDGVWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPRGVMCGAPVLSAERVRADGKEYEYSVECQEDSACPAAEERLPIEVVVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVCMDKTSATVICRKNASVSVQAQDRYYSSSWSEWASVPCN
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-12 (IL-12) is a pivotal cytokine that plays a crucial role in immune regulation and host defense against pathogens and tumors. IL-12 is a heterodimeric protein composed of two subunits, p35 and p40, encoded by separate genes. The p40 subunit, often referred to as IL-12 beta, has garnered significant research interest due to its involvement in immune responses. IL-12 promotes T cell differentiation into Th1 cells, enhances the production of interferon-gamma, and stimulates cytotoxic T lymphocytes and natural killer (NK) cell activity, making it essential for combating intracellular pathogens and malignancies. Dysfunctional IL-12 signaling is implicated in various autoimmune diseases and cancers, further highlighting its relevance in immunotherapy applications. Recombinant IL-12 beta protein has been developed for therapeutic purposes, including cancer vaccines and immune modulation strategies. Studies have demonstrated that delivering IL-12 beta can enhance anti-tumor immunity and improve treatment outcomes in preclinical and clinical settings. Consequently, ongoing research is focused on optimizing the production, delivery mechanisms, and therapeutic efficacy of recombinant IL-12 beta, aiming to harness its potential to improve cancer therapies and address unmet medical needs in immunological disorders.











