Analytical Data
-
Gene name
FUNDC1
- Application
-
Alternative Names
FUNDC1; FUN14 domain-containing protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IVP5
-
Expression Region
1-155aa
-
AA Sequence
MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS
-
Molecular Weight
43.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FUNDC1, short for FUN14 domain containing 1, is a key protein involved in mitochondrial dynamics and autophagy regulation. Recent studies have highlighted its critical role in cellular responses to stress, particularly under hypoxic conditions where it facilitates the selective autophagy of damaged mitochondria, a process known as mitophagy. FUNDC1 interacts with autophagy receptors and is modulated by post-translational modifications such as phosphorylation and ubiquitination, which influence its function and stability. Given its involvement in neurodegenerative diseases and cancer, understanding FUNDC1's mechanisms has significant implications for developing therapeutic strategies. Further research into its structure and potential as a drug target, particularly through recombinant protein studies, is essential to elucidate the pathways it regulates and its overall impact on cellular health. With the increasing recognition of mitochondrial dysfunction in various diseases, FUNDC1 represents a promising focus of investigation in the field of cell biology and therapeutic interventions.
