Cat: PA1000-8856

Recombinant Human PAFR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PAFR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PAFR;PAFR;Platelet-activating factor receptor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P25105

  • Expression Region

    1-342aa

  • AA Sequence

    MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of PAFR (Platelet-Activating Factor Receptor) recombinant proteins has gained significant attention due to the critical role that PAFR plays in various physiological and pathological processes. PAFR, a G-protein coupled receptor, is activated by platelet-activating factor, a phospholipid mediator involved in inflammation, immune responses, and cellular growth. Dysregulation of PAFR signaling has been implicated in several diseases, including cardiovascular disorders, asthma, and cancer, making it a potential therapeutic target. The recombinant expression of PAFR allows researchers to investigate its structural and functional properties in detail, aiding in the understanding of its role in health and disease. Additionally, recombinant PAFR proteins serve as valuable tools for the development of pharmacological agents, enabling the screening of small molecules or antibodies that may modulate PAFR activity. Advances in molecular biology techniques have facilitated the generation of high-quality recombinant PAFR proteins, which can be used in a range of applications, from biophysical studies to drug discovery. As research progresses, the insights gained from studying PAFR and its recombinant forms could lead to novel therapeutic strategies for managing diseases associated with PAFR dysfunction. This exciting area of research holds promise not only for advancing our knowledge of receptor biology but also for developing effective interventions in inflammation-related and other PAFR-associated conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US