Analytical Data
-
Gene name
PAFR
- Application
-
Alternative Names
PAFR；PAFR；Platelet-activating factor receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25105
-
Expression Region
1-342aa
-
AA Sequence
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of PAFR (Platelet-Activating Factor Receptor) recombinant proteins has gained significant attention due to the critical role that PAFR plays in various physiological and pathological processes. PAFR, a G-protein coupled receptor, is activated by platelet-activating factor, a phospholipid mediator involved in inflammation, immune responses, and cellular growth. Dysregulation of PAFR signaling has been implicated in several diseases, including cardiovascular disorders, asthma, and cancer, making it a potential therapeutic target. The recombinant expression of PAFR allows researchers to investigate its structural and functional properties in detail, aiding in the understanding of its role in health and disease. Additionally, recombinant PAFR proteins serve as valuable tools for the development of pharmacological agents, enabling the screening of small molecules or antibodies that may modulate PAFR activity. Advances in molecular biology techniques have facilitated the generation of high-quality recombinant PAFR proteins, which can be used in a range of applications, from biophysical studies to drug discovery. As research progresses, the insights gained from studying PAFR and its recombinant forms could lead to novel therapeutic strategies for managing diseases associated with PAFR dysfunction. This exciting area of research holds promise not only for advancing our knowledge of receptor biology but also for developing effective interventions in inflammation-related and other PAFR-associated conditions.
