Analytical Data
-
Gene name
BDKRB2
- Application
-
Alternative Names
BDKRB2；BKR2；B2 bradykinin receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30411
-
Expression Region
1-60aa
-
AA Sequence
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV EWLGWLNTIQ
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BDKRB2, also known as the bradykinin B2 receptor, is a G-protein coupled receptor that plays a significant role in various physiological processes, including inflammation, pain sensation, and vasodilation. Its relevance has been underscored in numerous studies linking it to cardiovascular disease, neuropathic pain, and other pathological conditions. The receptor interacts with the peptide bradykinin, initiating a cascade of cellular responses that modulate local and systemic effects in the body. Research on BDKRB2 recombinant proteins has gained momentum due to their potential therapeutic applications, including in pain management and the treatment of ischemic conditions. By producing and studying BDKRB2 in recombinant systems, researchers aim to elucidate the receptor’s structure-function relationship, explore its signaling pathways, and identify potential drug candidates that can selectively target BDKRB2. Moreover, as BDKRB2 is involved in the body’s response to injury and infection, understanding its mechanisms can provide insights for developing novel anti-inflammatory and analgesic therapies. The advancements in recombinant protein technology facilitate the detailed characterization of BDKRB2, paving the way for innovative approaches in drug discovery and therapeutic interventions targeting this crucial receptor in various diseases.
