Cat: IPD-X16498

Recombinant Human FCAR/CD89 Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FCAR/CD89

  • 简介

    The FCAR/CD89 protein is crucial and can specifically bind to the Fc region of immunoglobulin α to promote the production of cytokines. FCAR/CD89 binds to the Fc epsilon RI gamma 2 receptor, induces gamma 2 tyrosine phosphorylation, and is complexly involved in signaling pathways and immune responses. FCAR/CD89 Protein, Human (HEK293, His) is the recombinant human-derived FCAR/CD89 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Immunoglobulin Alpha Fc Receptor; IgA Fc Receptor; CD89; FCAR

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P24071-1

  • Expression Region

    Q22-N227

  • AA Sequence

    QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of FCAR (Fc alpha receptor) and CD89 (CD89 antigen) recombinant proteins has gained significant attention in immunology and therapeutic research due to their roles in the immune response. FCAR is a cell surface receptor predominantly expressed on myeloid cells, facilitating the interaction between IgA-bound pathogens and immune cells, thus enhancing immune responses. CD89, as the receptor for IgA, plays a crucial role in mediating IgA antibody-dependent cellular phagocytosis and inflammation, contributing to the body’s defense mechanisms against infections. Understanding the structure and function of FCAR/CD89 recombinant proteins can provide insights into their signaling pathways and interaction with pathogens. This knowledge is essential for developing novel immunotherapeutic strategies for treating diseases where immune regulation is compromised, such as autoimmune disorders and infections. Additionally, the production of these recombinant proteins allows for detailed studies on receptor-ligand interactions, which can reveal potential targets for drug development. Overall, the characterization of FCAR/CD89 recombinant proteins holds promise for advancing our understanding of immune responses and creating innovative therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US