Analytical Data
-
Gene name
ZNF683
- Application
-
Alternative Names
MGC33414; RP11 569G9.6; Zinc finger Protein 683; ZN683_HUMAN; ZNF 683; ZNF683
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IZ20
-
Expression Region
1-509 aa
-
AA Sequence
MALGGTGGSLSPSLDFQLFRGDQVFSACRPLPDMVDAHGPSCASWLCPLPLAPGRSALLACLQDLDLNLCTPQPAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQPERAGEGAPCPAFSSHNSSSPPPLQNRKSPSPLAFCPCPPVNSISKELPFLLHAFYPGYPLLLPPPNLFTYGALPSDQCPHLLMLPQDPSYPTMAMPSLLMMVNELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAPTDSPGLERGGMASPAKRVPLSSQTGTAALPYPLKKKNGKILYECNICGKSFGQLSNLKVHLRVHSGERPFQCALCQKSFTQLAHLQKHHLVHTGERPHKCSIPWVPGRNHWKSFQAWREREVCHKRFSSSSNLKTHLRLHSGARPFQCSVCRSRFTQHIHLKLHHRLHAPQPCGLVHTQLPLASLACLAQWHQGALDLMAVASEKHMGYDIDEVKVSSTSQGKARAVSLSSAGTPLVMGQDQNN
-
Molecular Weight
81.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF683, also known as GATA3-responsive zinc finger protein, is a member of the zinc finger protein family and plays a significant role in various biological processes, particularly in immune system regulation and cellular differentiation. Recent studies have shown that ZNF683 is critically involved in the development and function of innate lymphoid cells (ILCs), especially ILC2s, which are essential for maintaining homeostasis and responding to environmental stimuli. Furthermore, aberrations in ZNF683 expression have been implicated in the pathogenesis of several diseases, including allergies, asthma, and certain cancers, highlighting its potential as a therapeutic target. To better understand its functional mechanisms and interactions within cellular pathways, researchers have focused on generating recombinant ZNF683 proteins. These recombinant proteins serve as valuable tools for elucidating ZNF683's role in transcriptional regulation, as well as its interactions with other proteins and DNA elements. Therefore, investigation into ZNF683 recombinant proteins not only advances our comprehension of immune responses but also opens avenues for novel therapeutic strategies aimed at modulating ZNF683 activity in disease contexts.
