Analytical Data
-
Gene name
CD31/PECAM-1
-
简介
The CD31/PECAM-1 protein is a cell adhesion molecule critical for leukocyte transendothelial migration (TEM) under inflammatory conditions.CD31/PECAM-1 also regulates bradykinin receptor BDKRB2 activation and modulates ERK1/2 activation in endothelial cells.CD31/PECAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD31/PECAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Recombinant Mouse CD31/PECAM-1 binds to Recombinant Biotinylated Human Integrin alpha 8 beta 1 (HY-P73869) with an ED50 of 0.42 μg/mL. Measured by its binding ability in a functional ELISA. Recombinant Mouse CD31/PECAM-1 binds to Recombinant Biotinylated Human Integrin alpha 8 beta 1 with an ED50 of 0.42 μg/mL.
-
Alternative Names
Platelet endothelial cell adhesion molecule; PECAM-1; CD31; Pecam
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
Q08481
-
Expression Region
E18-K590
-
AA Sequence
EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK
-
Protein Length
Extracellular Domain
-
Molecular Weight
86-106 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD31, also known as Platelet Endothelial Cell Adhesion Molecule-1 (PECAM-1), is an immunoglobulin superfamily member primarily expressed on the surface of endothelial cells and platelets. This glycoprotein plays a crucial role in various physiological processes, including leukocyte migration, angiogenesis, and maintaining vascular integrity. Given its significant involvement in inflammation and immune responses, CD31/PECAM-1 has garnered considerable attention in both basic and clinical research. Studies indicate that CD31 facilitates cell-cell interactions and the transendothelial migration of leukocytes, thus influencing the pathophysiology of various diseases, including atherosclerosis, cancer, and autoimmune disorders. The investigation of recombinant CD31/PECAM-1 proteins has opened new avenues for therapeutic interventions, providing insights into the development of antibodies and inhibitors that target this protein for disease treatment or prevention. Furthermore, understanding the structural and functional characteristics of CD31 can aid in the design of targeted therapies aimed at modulating its activity in pathological conditions. As a result, research surrounding CD31/PECAM-1 recombinant proteins is pivotal in exploring novel strategies for alleviating detrimental vascular and inflammatory processes, highlighting its potential as a biomarker and therapeutic target in the development of targeted therapies.











