Analytical Data
-
Gene name
RAD18
- Application
-
Alternative Names
RAD18；RNF73；E3 ubiquitin-Protein ligase RAD18
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NS91
-
Expression Region
1-495aa
-
AA Sequence
MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN
-
Molecular Weight
72.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAD18 is a pivotal protein involved in the maintenance of genomic stability and the regulation of DNA damage response mechanisms. It serves as a E3 ubiquitin ligase, playing a critical role in mediating the monoubiquitination of proliferating cell nuclear antigen (PCNA) at sites of DNA damage, thereby facilitating the recruitment of DNA repair factors to sites needing repair. This action is essential for both translesion synthesis, allowing DNA polymerases to bypass lesions, and for coordinating homologous recombination repair pathways. The study of RAD18 has gained significance due to its involvement in various cancer types, where its dysregulation can lead to chromosomal instability and tumorigenesis. Furthermore, RAD18's potential as a therapeutic target is attracting attention, particularly in the context of enhancing the efficacy of existing chemotherapeutic agents. Understanding the molecular mechanisms by which RAD18 operates and its interactions with other proteins in the DNA damage response pathway is crucial for developing strategies aimed at improving cancer treatment outcomes and potentially overcoming drug resistance. Given that RAD18 is also implicated in other biological processes, such as cell cycle regulation and replication fork stability, ongoing research is essential to unravel its multifaceted roles in cellular homeostasis and disease.
