Analytical Data
-
Gene name
DCUN1D2
- Application
-
Alternative Names
DCUN1D2; C13orf17; DCUN1L2DCN1-like protein 2; DCUN1 domain-containing protein 2; Defective in cullin neddylation protein 1-like protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PH85
-
Expression Region
1-259aa
-
AA Sequence
MHKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYARPVVTGGKRSLF
-
Molecular Weight
56.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DCUN1D2 is a member of the DCUN1D family of proteins, which are known to play critical roles in cellular processes such as protein degradation, cell cycle regulation, and development. Research has indicated that DCUN1D2 may be involved in the regulation of the ubiquitin-proteasome system, which is essential for maintaining cellular homeostasis by controlling the degradation of misfolded or redundant proteins. Furthermore, mutations or dysregulation of DCUN1D2 have been associated with various diseases, including cancer and genetic disorders, making it a potential target for therapeutic intervention. Recent studies have focused on the characterization of DCUN1D2 as a recombinant protein to investigate its structural properties, binding interactions, and functional mechanisms in cellular pathways. By producing and purifying DCUN1D2 in a recombinant system, researchers aim to elucidate its role in ubiquitin ligase activity and its implications in disease. Understanding the function of DCUN1D2 not only contributes to the fundamental knowledge of protein homeostasis but also holds promise for developing targeted therapies that could mitigate the effects of its dysregulation in pathological conditions.
