Cat: IPD-X16319

Recombinant Human CD36 Protein(HEK293) , Avi & His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD36

  • 简介

    CD36 is a multifunctional glycoprotein that serves as a receptor for a variety of ligands, including thrombospondin and oxidized low-density lipoprotein. Ligand induces CD36 clusters, initiating signal transduction and internalization. CD36 Protein, Human (HEK293, His-Avi) is the recombinant human-derived CD36 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CD36 antigen; CD36; Collagen R; FAT; FATCHDS7; Glycoprotein IIIb; GPIIIb; GPIV; PAS IV; PAS-4; SCARB3; SRB3; SR-B3; Thrombospondin R; BDPLT10; CHDS7; GP3B

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-Avi;C-8*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P16671

  • Expression Region

    G30-N439

  • AA Sequence

    GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKIN

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    70-80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD36 is a multifunctional membrane glycoprotein that plays a critical role in various physiological and pathological processes, including fatty acid metabolism, inflammation, and immunity. It serves as a receptor for several ligands, including oxidized low-density lipoproteins (oxLDL), long-chain fatty acids, and various pathogens. The dysregulation of CD36 has been implicated in a range of diseases such as atherosclerosis, obesity, and diabetes. Given its importance in these conditions, the study of CD36 recombinant proteins has garnered significant interest. Researchers have focused on characterizing the structure and function of CD36, aiming to better understand its ligand-binding mechanisms and signaling pathways. Additionally, recombinant forms of CD36 can be utilized in various experimental models to assess its role in cell adhesion, migration, and inflammatory responses. This research is further enhanced by advances in protein engineering techniques, enabling the generation of CD36 variants with modified properties. Understanding the physiological and pathological roles of CD36 through recombinant protein studies may pave the way for developing targeted therapies for metabolic and cardiovascular diseases, thus highlighting its potential as a therapeutic target in clinical settings. Overall, the exploration of CD36 recombinant proteins is a rapidly evolving field that holds promise for uncovering new insights into health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US