Analytical Data
-
Gene name
IL-1R1
-
简介
IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM)[1]. IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB and MAPK pathway[4]. IL-1R1 Protein, Cynomolgus (HEK293, His) is a recombinant cynomolgus extracellular region of IL-1R1 (M1-T332) with a C-Terminal His tag, which is produced in HEK293 cells.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL1RA at 2 μg/mL (100 μl/well) can bind Cynomolgus IL1R1 His, the EC50 of Cynomolgus IL1R1 His is 2.5-15 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Human IL1RA at 2 μg/mL (100 μL/well) can bind Cynomolgus IL1R1. The ED50 for this effect is 3.208 ng/mL.
-
Alternative Names
Interleukin-1 receptor type 1; IL-1R-1; CD121a; IL1R1; IL1R; IL1RA; IL1RT1
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
F7GVA6
-
Expression Region
D21-T332
-
AA Sequence
DKCNEREEKIILVSSANEIDVRPCPLNPNEYKGTITWYKNDSKTPISTEQASRIHQHKKKLWFVPAKVEDSGHYYCVVRNSSYCLRIKITAKFVENEPNLCYNAEAIFKQRLPVAGDGGLVCPYMEFFKDENNELPKLLWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETIEVDLGSQIQLICNVTGQLSDTAYWKWNGSFIDEDDPVLGEDYYSVENPANKRRSTLITVLNISETESRFYKHPFTCLARNTHGMDAAYVQLIYPVT
-
Protein Length
Partial
-
Molecular Weight
47-75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-1 receptor type 1 (IL-1R1) is a crucial component of the immune response, serving as the primary signaling receptor for interleukin-1 (IL-1), a pro-inflammatory cytokine involved in various physiological and pathological processes. The study of IL-1R1 has gained significant attention due to its role in mediating immune responses, particularly in inflammatory diseases, autoimmune disorders, and certain cancers. Dysregulation of IL-1R1 signaling has been linked to a range of health issues, making it a promising target for therapeutic interventions. Research in this area has focused on understanding the structural and functional dynamics of IL-1R1, the mechanisms by which it influences downstream signaling pathways, and its interactions with other proteins. Recombinant IL-1R1 protein plays a vital role in these studies, allowing for detailed investigations of the receptor's function, ligand binding characteristics, and potential modulation by small molecules or antibodies. Moreover, IL-1R1 recombinant proteins are also being developed for use in diagnostic kits and therapeutic strategies aimed at controlling inappropriate inflammatory responses. Overall, the ongoing research surrounding IL-1R1 recombinant protein is essential for advancing our understanding of immune regulation and developing effective treatments for a variety of inflammatory and autoimmune conditions.
