Analytical Data
-
Gene name
PDGF R beta
-
简介
PDGF R beta Protein, a receptor tyrosine kinase, binds ligands PDGFA, PDGFB, and PDGFD, forming homodimers or heterodimers.Ligand binding activates diverse signaling cascades in PDGF R beta, with responses contingent on the specific ligand.The modulation of responses involves heterodimer formation with another receptor, PDGFRB.PDGF R beta Protein, Rat (HEK293, His) is the recombinant rat-derived PDGF R beta protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Platelet-derived growth factor receptor beta; PDGF-R-beta; PDGFR-1; CD140b; PDGFRB
-
Species
Rat
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q05030
-
Expression Region
L32-V531
-
AA Sequence
LVITPPGPEFVLNISSTFVLTCSSSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFIGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINVTVIENGYVRLLETLEDVQIAELHRSRTLQVVFEAYPTPSVLWFKDNRTLGDSSAGELVLSTRNVSETRYVSELTLVRVKVSEAGYYTMRAFHADDQVQLSFKLQVNVPVRVLELSESHPANGEQILRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGRDSQEVTVVPHSLPFKV
-
Protein Length
Extracellular Domain
-
Molecular Weight
80-110 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research background of PDGF R beta (Platelet-Derived Growth Factor Receptor Beta) recombinant protein centers on its significant role in various cellular processes, including proliferation, survival, and differentiation. PDGF R beta is a receptor for platelet-derived growth factors, which are essential for embryonic development, tissue repair, and wound healing. Dysregulation of this receptor is implicated in several diseases, including cancer, pulmonary hypertension, and fibrosis, making it a critical target for therapeutic interventions. The production of PDGF R beta recombinant protein allows for in-depth studies of its structure and function, facilitating the understanding of its signaling pathways and interactions with ligands. By utilizing recombinant DNA technology, researchers can generate large quantities of this protein for biochemical assays, drug discovery, and the development of targeted therapies. Moreover, studying PDGF R beta can provide insights into its role in stem cell biology and regenerative medicine, as it influences stem cell niche environments. Overall, the exploration of PDGF R beta recombinant protein presents opportunities to advance our comprehension of its biological functions and potential clinical applications in treating related disorders.











