Analytical Data
-
Gene name
Angiopoietin-4
-
简介
Angiopoietin 4 protein (ANGPT4) critically binds to TEK/TIE2, regulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation. In addition to regulation, ANGPT4 promotes endothelial cell survival, migration, and angiogenesis. Angiopoietin-4 Protein, Human (HEK293, Fc) is the recombinant human-derived Angiopoietin-4 protein, expressed by HEK293 , with N-hFc labeled tag.
- Application
-
Biological Activity
Measured by its ability to compete with biotinylated rhAng-2 for binding to immobilized Tie-2 in a functional ELISA. When Recombinant Human Tie-2 Protein (HY-P72450) is immobilized at 5 µg/mL (100 µL/well), Recombinant Human Angiopoietin-4 binds with an ED50 of 0.1030 μg/mL, in the presence of 5 µg/mL biotinylated rhAng-2 (HY-P72828). Measured by its ability to compete with biotinylated rhAng-2 for binding to immobilized Tie-2 in a functional ELISA. When Recombinant Human Tie-2 Protein (HY-P72450) is immobilized at 5 µg/mL (100 µL/well), Recombinant Human Angiopoietin-4 binds with an ED50 of 0.1030 μg/mL, in the presence of 5 µg/mL biotinylated rhAng-2 (HY-P72828).
-
Alternative Names
Angiopoietin-4; AGP4; ANG-3; ANG-4; ANGPT4
-
Species
Human
-
Source
HEK293
-
Tag
N-hFc
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
Q9Y264-1
-
Expression Region
M282-I503
-
AA Sequence
MAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMMIRPLDI
-
Protein Length
Partial
-
Molecular Weight
58-77 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Angiopoietin-4 (Ang-4) is a member of the angiopoietin family of proteins, which play crucial roles in vascular development and function. It is primarily involved in the regulation of angiogenesis, the formation of new blood vessels from pre-existing ones, which is critical in various physiological and pathological processes, including wound healing, inflammation, and cancer progression. Unlike other angiopoietins, Ang-4 exhibits unique properties that allow it to function both as an angiogenic factor and a modulator of vascular permeability. Recent studies have identified Ang-4's potential role in promoting tumor metastasis and influencing immune responses, making it a target of interest in cancer research and therapeutic applications. Recombinant Ang-4 proteins are being developed for various experimental and clinical uses, such as studying its mechanisms in cell signaling, evaluating its effects on endothelial cell behavior, and exploring its therapeutic potential in diseases characterized by aberrant angiogenesis. Understanding the function and regulation of Ang-4 can provide insights into novel treatment strategies for cancer and other angiogenesis-related conditions.
