Analytical Data
-
Gene name
Angiopoietin-2
-
简介
ANGPT2 is a secreted factor on the angiopoietin/Tie (tyrosine kinase with Ig and EGF homology domains) signaling pathway and is involved in tumor angiogenesis. In the presence of ANGPT1, ANGPT2 antagonizes ANGPT1-mediated Tie2 phosphorylation, leading to vessel sprouting or degeneration depending on the level of VEGF-A. Overexpression or inhibition of ANGPT2 increases or decreases angiogenic capacity, respectively. Angiopoietin-2 Protein, Rhesus macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived Angiopoietin-2 protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Biological Activity
Immobilized Rhesus TIE2 His at 2 μg/ml (100 μl/well) can bind Rhesus Macaque Angiopoietin-2. The ED50 for this effect is 173.6 ng/mL. Immobilized Rhesus TIE2 His at 2 μg/mL (100 μL/well) can bind Rhesus Macaque Angiopoietin-2. The ED50 for this effect is 173.6 ng/mL.
-
Alternative Names
rRhANG2, Fc; AGPT2; ANG2; ANG-2; angiopoietin 2; Angiopoietin-2; angiopoietin-2a; angiopoietin-2B; angiopoitin 2; ANGPT2; Tie2-ligand
-
Species
Rhesus Macaque
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
XM_001097949
-
Expression Region
Y19-F495
-
AA Sequence
YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSKDPTVAKEEQISFRDCAEVFKSGHTTNGVYTLTLPNSTEEVKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF
-
Protein Length
Partial
-
Molecular Weight
90-120 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Angiopoietin-2 (Ang-2) is a pivotal regulator of angiogenesis, playing a critical role in vascular development, homeostasis, and inflammation. It functions as a natural antagonist to Angiopoietin-1 (Ang-1), which promotes vessel stability and maturation by activating the Tie2 receptor. Under pathological conditions, such as tumor growth, chronic inflammation, and cardiovascular diseases, the expression of Ang-2 is upregulated, leading to increased vascular permeability and aberrant angiogenesis. This has positioned Ang-2 as a potential therapeutic target; therefore, understanding its functional mechanisms is of paramount importance. The development of recombinant Ang-2 proteins has facilitated the exploration of its role in these processes, enabling researchers to elucidate its interactions with various cellular pathways and its impact on endothelial cell behavior. Furthermore, recombinant Ang-2 has been investigated as a biomarker for disease progression and a potential target for therapeutic interventions, particularly in oncology and vascular-related disorders. By studying the properties and effects of Ang-2, researchers aim to develop new strategies for modulating angiogenesis, ultimately leading to innovative treatments that can manage diseases characterized by dysregulated blood vessel formation. The advances in recombinant protein technologies have also allowed for detailed structural and functional analyses of Ang-2, enhancing our understanding of its mechanism of action and paving the way for the development of Ang-2 inhibitors or modulators that could benefit clinical outcomes in various disease settings. Overall, the investigation of recombinant Angiopoietin-2 is a promising field that combines molecular biology, therapeutic development, and clinical application, with potential implications for treating a range of vascular and oncological conditions.











