Cat: IPD-X12790

Recombinant Dog Angiopoietin-2 Protein(HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Angiopoietin-2

  • 简介

    ANGPT2/Angiopoietin-2 (dog) complexly regulates angiogenesis by binding to TEK/TIE2, competitively affecting ANGPT1 signaling. It independently induces TEK/TIE2 phosphorylation and, in the absence of VEGF, may cause endothelial cell apoptosis, thereby promoting vascular regression. ANGPT2/Angiopoietin-2, Dog (HEK293, His) is the recombinant dog-derived ANGPT2/Angiopoietin-2, Dog, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Dog Angiopoietin-2 at 10 μg/mL (100 μL/well) can bind human TIE-2. The ED50 for this effect is 10-30 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Dog Angiopoietin-2 at 10 μg/mL (100 μL/well) can bind human TIE-2. The ED50 for this effect is 16.76 ng/mL.

  • Alternative Names

    angiopoietin 2; angiopoietin-2; Ang2; ANG-2; Tie2-ligand; angiopoietin-2B; angiopoietin-2a; ANG2; AGPT2;

  • Species

    Dog

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    A0A8J8

  • Expression Region

    Y19-F495

  • AA Sequence

    YNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLTFPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVFQVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    60-85 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Angiopoietin-2 (Ang-2) is a pivotal regulator of angiogenesis, playing a critical role in vascular development, homeostasis, and inflammation. It functions as a natural antagonist to Angiopoietin-1 (Ang-1), which promotes vessel stability and maturation by activating the Tie2 receptor. Under pathological conditions, such as tumor growth, chronic inflammation, and cardiovascular diseases, the expression of Ang-2 is upregulated, leading to increased vascular permeability and aberrant angiogenesis. This has positioned Ang-2 as a potential therapeutic target; therefore, understanding its functional mechanisms is of paramount importance. The development of recombinant Ang-2 proteins has facilitated the exploration of its role in these processes, enabling researchers to elucidate its interactions with various cellular pathways and its impact on endothelial cell behavior. Furthermore, recombinant Ang-2 has been investigated as a biomarker for disease progression and a potential target for therapeutic interventions, particularly in oncology and vascular-related disorders. By studying the properties and effects of Ang-2, researchers aim to develop new strategies for modulating angiogenesis, ultimately leading to innovative treatments that can manage diseases characterized by dysregulated blood vessel formation. The advances in recombinant protein technologies have also allowed for detailed structural and functional analyses of Ang-2, enhancing our understanding of its mechanism of action and paving the way for the development of Ang-2 inhibitors or modulators that could benefit clinical outcomes in various disease settings. Overall, the investigation of recombinant Angiopoietin-2 is a promising field that combines molecular biology, therapeutic development, and clinical application, with potential implications for treating a range of vascular and oncological conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US