Cat: IPD-X14134

Recombinant Mouse GH/Somatotropin Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GH/Somatotropin

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is ≤0.1051 ng/mL, corresponding to a specific activity is ≥9.515×106 U/mg. Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.1051ng/mL, corresponding to a specific activity is 9.515×106 U/mg.

  • Alternative Names

    rMuSomatotropin/GH; Somatotropin; Growth Hormone; Gh1; Gh

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    P06880

  • Expression Region

    F27-F216

  • AA Sequence

    FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    20.0-23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Recombinant human growth hormone (rhGH), also known as somatotropin, has emerged as a significant therapeutic agent in the field of endocrinology and biotechnology. Initially derived from pituitary glands, its clinical use was limited due to the risks of contamination and variability in hormone activity. In the 1980s, advancements in recombinant DNA technology enabled the production of rhGH in bacteria and yeast, providing a safer and more consistent source. The hormone plays a crucial role in growth and metabolism, promoting growth in children with growth hormone deficiencies and aiding in tissue repair and metabolism in adults. Its applications have expanded beyond traditional uses to include treatments for conditions such as Turner syndrome, Prader-Willi syndrome, and cachexia in chronic illnesses. Furthermore, rhGH has gained attention in sports medicine for its potential to enhance athletic performance, leading to discussions about its ethical implications and regulation in sports. Ongoing research aims to better understand its mechanisms, optimize therapies, and explore novel applications, such as in regenerative medicine and age-related disorders. As a result, rhGH represents a pivotal advancement in hormone replacement therapies, improving the quality of life for many patients while continuously evolving with technological advancements in biotechnology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US