Analytical Data
-
Gene name
IL-7RA
-
简介
IL-7RA (also known as CD127) is a type 1 membrane glycoprotein folded to bind and mediate the action of IL7 and other alpha helical cytokines. IL-7RA is mainly expressed by cells of the lymphoid lineage. IL-7RA also acts as a receptor for thymic stromal lymphopoietin (TSLP). CD127/IL-7RA Protein, Cynomolgus (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 235 amino acids (M1-P235)[1][2].
- Application
-
Alternative Names
Interleukin-7 receptor subunit alpha; IL7R; IL-7R-alpha; CD127
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-His
-
Purity
> 90% as determined by SDS-PAGE.
-
Uniprot
Q38IC7
-
Expression Region
E21-P235
-
AA Sequence
ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLSFRKLQEIYFIETKKFLLIGKSNICVKVGGKSLTCKKIDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWMHVNLSSTKLTLLQRNLQPEAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSP
-
Protein Length
Partial
-
Molecular Weight
26.3-50 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-7 receptor alpha (IL-7RA) is a pivotal component of the immune system, playing a crucial role in lymphocyte development, differentiation, and homeostasis. It is primarily involved in the signaling pathways of cytokines, particularly in the proliferation and survival of T and B cells. Dysregulation or mutations in IL-7RA have been associated with various immunological disorders, including severe combined immunodeficiency (SCID) and autoimmune diseases. The therapeutic potential of recombinant IL-7RA proteins has garnered significant interest due to their ability to enhance immune responses, particularly in the context of cancer and viral infections. Research into the structure, function, and mechanisms of IL-7RA has led to advancements in understanding its role in immune regulation. Additionally, recombinant forms of IL-7RA are being explored for their potential in restoring immune function in immunocompromised patients and improving the effectiveness of immunotherapies. Investigating IL-7RA-based therapies could provide novel approaches to treat a wide range of diseases, highlighting its importance in both basic and translational immunology research.











