Cat: IPD-X14042

Recombinant Human Prolactin Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Prolactin

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Prolactin; PRL;

  • Species

    Human

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01236

  • Expression Region

    L29-C227

  • AA Sequence

    LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    24.8 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Prolactin, a hormone primarily produced by the pituitary gland, plays a crucial role in lactation, reproductive health, and immune regulation. Its diverse physiological functions have made it a target of interest in various fields, including endocrinology, reproductive biology, and oncology. The recombinant form of prolactin (rProlactin) has been developed to study its biological activities and therapeutic potentials. Early research focused on understanding its structure-function relationship and delineating its signaling pathways, which are critical for lactation and other reproductive processes. Advances in biotechnology have facilitated the production of rProlactin using recombinant DNA technology, enabling the generation of pure and biologically active hormone for experimental use. Studies have indicated that rProlactin can influence cell proliferation, differentiation, and apoptosis, highlighting its potential implications in cancer studies, particularly breast cancer, where prolactin signaling may affect tumor progression. Additionally, understanding the interactions of rProlactin with its receptors can provide insights into pathophysiological conditions associated with prolactin dysregulation, such as hyperprolactinemia and infertility. Furthermore, rProlactin's therapeutic applications are being explored, including its roles in enhancing immune responses and addressing conditions linked to prolactin deficiency. Ongoing research aims to elucidate the molecular mechanisms underlying prolactin's actions, optimize its recombinant production, and evaluate its pharmacological properties, presenting a comprehensive approach to harnessing the potential of prolactin in both basic research and clinical medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US