Cat: IPD-X13975

Recombinant Human CG alpha Protein(HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CG alpha

  • 简介

    The CG alpha protein, a shared alpha chain in glycoprotein hormones (TSH, LH, FSH, CG), binds to receptors, initiating signaling pathways. Heterodimeric hormones involve CG alpha and a specific beta chain (TSHB, LHB, FSHB, CGB), imparting biological specificity. CGA-CGB3 Heterodimer Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived CGA-CGB3 Heterodimer protein, expressed by HEK293 , with C-6*His labeled tag. CGA-CGB3 Heterodimer Protein, Human (HEK293, His), has molecular weight of 22 & 30-35 kDa, respectively.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized LSHR protein at 2 μg/mL(100 μL/well) can bind CGA-CGB3. The ED50 for this effect is 1.163 µg/mL . Measured by its binding ability in a functional ELISA. Immobilized LSHR protein at 2 μg/mL(100 μL/well) can bind CGA-CGB3. The ED50 for this effect is 1163ng/mL.

  • Alternative Names

    Glycoprotein hormones alpha chain; CG-alpha; FSH-alpha; CGA

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01215 (A25-S116)&P0DN86

  • Expression Region

    P01215 (A25-S116)&P0DN86 (S21-Q165)

  • AA Sequence

    APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

  • Protein Length

    Partial

  • Molecular Weight

    22&30-35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CG alpha recombinant protein, derived from the calcitonin gene (CALCA), has garnered significant interest in biomedical research due to its potential applications in various therapeutic areas. Calcitonin, originally identified as a hormone involved in calcium homeostasis, has been shown to possess neuroprotective and analgesic properties, making CG alpha a promising candidate for treating pain disorders and neurodegenerative conditions. Recombinant technology allows for the production of this protein in a controlled manner, facilitating studies on its structure-function relationships and biological activities. Additionally, the use of CG alpha in drug development is appealing because it can interact with a variety of receptors implicated in pain pathways. Research has also explored its potential role in modulating bone metabolism and cardiovascular health. As scientists delve deeper into the mechanisms of CG alpha, understanding its signaling pathways could lead to novel therapeutic strategies, particularly in conditions where traditional treatments have fallen short. Furthermore, advancements in recombinant protein production technology enhance the scalability and efficiency of CG alpha synthesis, paving the way for clinical applications. Overall, the ongoing research into CG alpha recombinant protein is poised to reveal important insights that could inform innovative treatments in medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US